BLASTX nr result
ID: Atropa21_contig00041801
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00041801 (704 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT38798.1| hypothetical protein SDM1_47t00009 [Solanum demis... 45 8e-08 >gb|AAT38798.1| hypothetical protein SDM1_47t00009 [Solanum demissum] Length = 182 Score = 45.4 bits (106), Expect(2) = 8e-08 Identities = 19/32 (59%), Positives = 24/32 (75%) Frame = +2 Query: 584 QQFHHLECQIAILLHGHNLYGHLDGSTLSPPE 679 Q F + Q ++L+HGH+LYGHLDGS LS PE Sbjct: 35 QNFSTWKAQFSMLMHGHDLYGHLDGSALSRPE 66 Score = 37.7 bits (86), Expect(2) = 8e-08 Identities = 16/26 (61%), Positives = 20/26 (76%) Frame = +3 Query: 534 LIQFNL*SQLPIKLSGSNNFTTWNAK 611 ++QFN SQ PIKL GS NF+TW A+ Sbjct: 18 IVQFNPASQFPIKLLGSQNFSTWKAQ 43