BLASTX nr result
ID: Atropa21_contig00041593
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00041593 (543 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006347554.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 ref|XP_004235466.1| PREDICTED: pentatricopeptide repeat-containi... 98 1e-18 gb|EMJ07903.1| hypothetical protein PRUPE_ppa023974mg [Prunus pe... 61 2e-07 ref|XP_002519997.1| pentatricopeptide repeat-containing protein,... 58 1e-06 ref|XP_004298102.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 >ref|XP_006347554.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like isoform X1 [Solanum tuberosum] Length = 1476 Score = 100 bits (248), Expect = 3e-19 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = +3 Query: 3 FARLALLSNEKREKIIQADIEGRREKLAKLKSTAVTKRKNTKSFRMNKFARVSSTA 170 FARLALLSNEKREK+IQADIEGRREKLAKLKSTAVTKR+NTKSFRMNKF RVS A Sbjct: 1420 FARLALLSNEKREKVIQADIEGRREKLAKLKSTAVTKRRNTKSFRMNKFVRVSGPA 1475 >ref|XP_004235466.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like [Solanum lycopersicum] Length = 1464 Score = 97.8 bits (242), Expect = 1e-18 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = +3 Query: 3 FARLALLSNEKREKIIQADIEGRREKLAKLKSTAVTKRKNTKSFRMNKFARVSSTA 170 FARLALLSNEKREK+IQADIEGRREKLAKL+STAVTKR+NTK+FRMNKF RVS A Sbjct: 1408 FARLALLSNEKREKVIQADIEGRREKLAKLRSTAVTKRRNTKNFRMNKFVRVSGPA 1463 >gb|EMJ07903.1| hypothetical protein PRUPE_ppa023974mg [Prunus persica] Length = 1353 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/58 (55%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 3 FARLALLSNEKREKIIQADIEGRREKLAKLKSTAVTKR-KNTKSFRMNKFARVSSTAN 173 FARLALLS+EKREK+IQ+DIEGR+EKL K+K +R K R K+ R S+ +N Sbjct: 1284 FARLALLSDEKREKVIQSDIEGRKEKLEKMKENDNPRRVSRIKKLRKRKYVRPSTLSN 1341 >ref|XP_002519997.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540761|gb|EEF42321.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1429 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/52 (59%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = +3 Query: 3 FARLALLSNEKREKIIQADIEGRREKLAKLKSTAVTKRKN-TKSFRMNKFAR 155 FA+LALLS++KR+K I ADIEGR+EKL KLKS +RKN T R +F R Sbjct: 1360 FAKLALLSDDKRQKAIHADIEGRKEKLEKLKSKVDLERKNKTNKLRRRRFIR 1411 >ref|XP_004298102.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 1496 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/52 (55%), Positives = 39/52 (75%) Frame = +3 Query: 3 FARLALLSNEKREKIIQADIEGRREKLAKLKSTAVTKRKNTKSFRMNKFARV 158 FARLALLS+EKRE++IQADIEGR+EKL K++ KR N R+N+ ++ Sbjct: 1425 FARLALLSDEKRERVIQADIEGRKEKLEKMR-----KRGNVDPRRVNRIKKL 1471