BLASTX nr result
ID: Atropa21_contig00040819
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00040819 (545 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004230006.1| PREDICTED: pentatricopeptide repeat-containi... 80 2e-13 ref|XP_006339749.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-11 >ref|XP_004230006.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial-like [Solanum lycopersicum] Length = 561 Score = 80.5 bits (197), Expect = 2e-13 Identities = 39/43 (90%), Positives = 40/43 (93%) Frame = +2 Query: 2 RVLALAASGDVDPETWGVLVDKFVTDIHNVCAILDKILSENEV 130 RVLALAASGDVDPETWGVLV KFVTDI NVCA+LDK LSENEV Sbjct: 519 RVLALAASGDVDPETWGVLVAKFVTDIQNVCAVLDKTLSENEV 561 >ref|XP_006339749.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial-like [Solanum tuberosum] Length = 564 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +2 Query: 2 RVLALAASGDVDPETWGVLVDKFVTDIHNVCAILDKILSENEV 130 RVLALAASGDVD ETWGVLV KFVT++ NVC++LDK LSENEV Sbjct: 522 RVLALAASGDVDSETWGVLVAKFVTNVQNVCSVLDKTLSENEV 564