BLASTX nr result
ID: Atropa21_contig00040725
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00040725 (514 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004239460.1| PREDICTED: uncharacterized protein LOC101262... 57 2e-09 >ref|XP_004239460.1| PREDICTED: uncharacterized protein LOC101262616 [Solanum lycopersicum] Length = 227 Score = 57.4 bits (137), Expect(2) = 2e-09 Identities = 29/56 (51%), Positives = 33/56 (58%) Frame = -3 Query: 485 HLPHQSIYCHNGINXXXXXXXXXXXXSVDHKTWQP*KLLELYNDHLHNYERTSHYQ 318 HLPHQSIY H+GI SV+ K K +LYN H+HNYERTSHYQ Sbjct: 143 HLPHQSIYFHDGIILLLSLSWLLKGSSVEQKRRATLKSFQLYNYHVHNYERTSHYQ 198 Score = 30.0 bits (66), Expect(2) = 2e-09 Identities = 19/31 (61%), Positives = 24/31 (77%) Frame = -2 Query: 336 KDISLPVRSTLKAN*MDTRVLLAELEQQYRI 244 +DI++ VRSTLKA DT +LLAEL+ Q RI Sbjct: 198 QDINI-VRSTLKAITTDTCLLLAELKLQSRI 227