BLASTX nr result
ID: Atropa21_contig00040436
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00040436 (451 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006367250.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 62 1e-07 ref|XP_004249589.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 62 1e-07 ref|XP_004238462.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 60 3e-07 >ref|XP_006367250.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 38-like [Solanum tuberosum] Length = 514 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -2 Query: 102 RSAVFNLLCDDRDNMIMSKIENHFNHQVTEITSY 1 + A+FNLLC DRDNM+MSKIENHFNHQV EI S+ Sbjct: 465 KGAIFNLLCSDRDNMLMSKIENHFNHQVAEIPSW 498 >ref|XP_004249589.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 38-like [Solanum lycopersicum] Length = 508 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -2 Query: 102 RSAVFNLLCDDRDNMIMSKIENHFNHQVTEITSY 1 + A+FNLLC DRDNM+MSKIENHFNHQV EI S+ Sbjct: 459 KGAIFNLLCSDRDNMLMSKIENHFNHQVAEIPSW 492 >ref|XP_004238462.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 38-like [Solanum lycopersicum] Length = 499 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 102 RSAVFNLLCDDRDNMIMSKIENHFNHQVTEIT 7 + A+FNLLC DRDNM+MSKIENHFNHQV EI+ Sbjct: 451 KGAIFNLLCSDRDNMLMSKIENHFNHQVAEIS 482