BLASTX nr result
ID: Atropa21_contig00040415
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00040415 (488 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006342309.1| PREDICTED: xylosyltransferase 1-like [Solanu... 58 1e-06 ref|XP_004235090.1| PREDICTED: xylosyltransferase 1-like [Solanu... 58 1e-06 ref|XP_006588324.1| PREDICTED: xylosyltransferase 2-like, partia... 58 1e-06 ref|XP_006602896.1| PREDICTED: xylosyltransferase 1-like [Glycin... 56 4e-06 ref|XP_004963343.1| PREDICTED: xylosyltransferase 1-like [Setari... 56 4e-06 tpg|DAA47720.1| TPA: hypothetical protein ZEAMMB73_782256 [Zea m... 56 4e-06 ref|XP_002442623.1| hypothetical protein SORBIDRAFT_08g023170 [S... 56 4e-06 >ref|XP_006342309.1| PREDICTED: xylosyltransferase 1-like [Solanum tuberosum] Length = 427 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +3 Query: 288 DLIHAFSNLPRDLNFIDHTSDIGWKE 365 DLIHAFS+LPRDLNFIDHTSDIGWKE Sbjct: 195 DLIHAFSDLPRDLNFIDHTSDIGWKE 220 >ref|XP_004235090.1| PREDICTED: xylosyltransferase 1-like [Solanum lycopersicum] Length = 426 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +3 Query: 288 DLIHAFSNLPRDLNFIDHTSDIGWKE 365 DLIHAFS+LPRDLNFIDHTSDIGWKE Sbjct: 192 DLIHAFSDLPRDLNFIDHTSDIGWKE 217 >ref|XP_006588324.1| PREDICTED: xylosyltransferase 2-like, partial [Glycine max] Length = 245 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 273 SFS*LDLIHAFSNLPRDLNFIDHTSDIGWKE 365 +F +DL+HAFS+LPRDLNFIDHTSDIGWK+ Sbjct: 6 NFDWVDLLHAFSHLPRDLNFIDHTSDIGWKD 36 >ref|XP_006602896.1| PREDICTED: xylosyltransferase 1-like [Glycine max] Length = 435 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/26 (88%), Positives = 26/26 (100%) Frame = +3 Query: 288 DLIHAFSNLPRDLNFIDHTSDIGWKE 365 DL+HAFS+LPRDLNFIDHTSDIGWK+ Sbjct: 201 DLLHAFSHLPRDLNFIDHTSDIGWKD 226 >ref|XP_004963343.1| PREDICTED: xylosyltransferase 1-like [Setaria italica] Length = 426 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = +3 Query: 288 DLIHAFSNLPRDLNFIDHTSDIGWKE 365 DLIH FS LPRDLNFIDHTSDIGWKE Sbjct: 192 DLIHVFSKLPRDLNFIDHTSDIGWKE 217 >tpg|DAA47720.1| TPA: hypothetical protein ZEAMMB73_782256 [Zea mays] Length = 465 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = +3 Query: 288 DLIHAFSNLPRDLNFIDHTSDIGWKE 365 DLIH FS LPRDLNFIDHTSDIGWKE Sbjct: 231 DLIHVFSKLPRDLNFIDHTSDIGWKE 256 >ref|XP_002442623.1| hypothetical protein SORBIDRAFT_08g023170 [Sorghum bicolor] gi|241943316|gb|EES16461.1| hypothetical protein SORBIDRAFT_08g023170 [Sorghum bicolor] Length = 425 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = +3 Query: 288 DLIHAFSNLPRDLNFIDHTSDIGWKE 365 DLIH FS LPRDLNFIDHTSDIGWKE Sbjct: 191 DLIHVFSKLPRDLNFIDHTSDIGWKE 216