BLASTX nr result
ID: Atropa21_contig00039617
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00039617 (566 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004246502.1| PREDICTED: putative pentatricopeptide repeat... 78 1e-12 ref|XP_006341234.1| PREDICTED: putative pentatricopeptide repeat... 74 2e-11 ref|XP_004494044.1| PREDICTED: putative pentatricopeptide repeat... 66 5e-09 gb|EXB54575.1| hypothetical protein L484_019144 [Morus notabilis] 64 2e-08 ref|XP_006481751.1| PREDICTED: putative pentatricopeptide repeat... 64 3e-08 ref|XP_006430175.1| hypothetical protein CICLE_v10011274mg [Citr... 64 3e-08 gb|EPS64087.1| hypothetical protein M569_10688 [Genlisea aurea] 64 3e-08 ref|XP_004305658.1| PREDICTED: putative pentatricopeptide repeat... 64 3e-08 gb|ESW16837.1| hypothetical protein PHAVU_007G188900g [Phaseolus... 62 8e-08 ref|XP_003537073.1| PREDICTED: putative pentatricopeptide repeat... 62 1e-07 gb|EMJ04957.1| hypothetical protein PRUPE_ppa003558mg [Prunus pe... 62 1e-07 ref|XP_002276416.2| PREDICTED: putative pentatricopeptide repeat... 62 1e-07 emb|CBI30310.3| unnamed protein product [Vitis vinifera] 62 1e-07 gb|EOY08282.1| Pentatricopeptide repeat (PPR) superfamily protei... 61 2e-07 ref|NP_187753.1| mitochondrial RNA editing factor 10 [Arabidopsi... 61 2e-07 ref|XP_006395522.1| hypothetical protein EUTSA_v10003772mg [Eutr... 60 3e-07 ref|XP_002882733.1| pentatricopeptide repeat-containing protein ... 60 3e-07 ref|XP_006407445.1| hypothetical protein EUTSA_v10022435mg [Eutr... 60 4e-07 ref|XP_004156253.1| PREDICTED: putative pentatricopeptide repeat... 60 5e-07 ref|XP_004143385.1| PREDICTED: putative pentatricopeptide repeat... 60 5e-07 >ref|XP_004246502.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460-like [Solanum lycopersicum] Length = 643 Score = 78.2 bits (191), Expect = 1e-12 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 3 FVKRVSKTVDRLFMVRDATRFHHFQNGTCSCNDYW 107 FVKRVSKTVDRLF+VRDATRFHHF+NGTCSCNDYW Sbjct: 609 FVKRVSKTVDRLFVVRDATRFHHFRNGTCSCNDYW 643 >ref|XP_006341234.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460-like [Solanum tuberosum] Length = 646 Score = 74.3 bits (181), Expect = 2e-11 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 FVKRVSKTVDRLFMVRDATRFHHFQNGTCSCNDYW 107 FVKRVSK VDRLF+VRD TRFHHF+NGTCSCNDYW Sbjct: 612 FVKRVSKIVDRLFVVRDVTRFHHFRNGTCSCNDYW 646 >ref|XP_004494044.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460-like [Cicer arietinum] Length = 641 Score = 66.2 bits (160), Expect = 5e-09 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +3 Query: 3 FVKRVSKTVDRLFMVRDATRFHHFQNGTCSCNDYW 107 F+K VSK VDR F+VRDATRFHHF+NG CSC DYW Sbjct: 607 FIKLVSKIVDRQFIVRDATRFHHFRNGVCSCKDYW 641 >gb|EXB54575.1| hypothetical protein L484_019144 [Morus notabilis] Length = 636 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +3 Query: 3 FVKRVSKTVDRLFMVRDATRFHHFQNGTCSCNDYW 107 F+K VSK VDR F+VRDATRFHHF++G CSC DYW Sbjct: 602 FIKLVSKIVDRKFVVRDATRFHHFKDGVCSCRDYW 636 >ref|XP_006481751.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460-like [Citrus sinensis] Length = 636 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +3 Query: 3 FVKRVSKTVDRLFMVRDATRFHHFQNGTCSCNDYW 107 F+K VSK VDR F+VRDATRFHHF++G CSC DYW Sbjct: 602 FIKLVSKIVDRQFIVRDATRFHHFKSGFCSCKDYW 636 >ref|XP_006430175.1| hypothetical protein CICLE_v10011274mg [Citrus clementina] gi|557532232|gb|ESR43415.1| hypothetical protein CICLE_v10011274mg [Citrus clementina] Length = 636 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +3 Query: 3 FVKRVSKTVDRLFMVRDATRFHHFQNGTCSCNDYW 107 F+K VSK VDR F+VRDATRFHHF++G CSC DYW Sbjct: 602 FIKLVSKIVDRQFIVRDATRFHHFKSGFCSCKDYW 636 >gb|EPS64087.1| hypothetical protein M569_10688 [Genlisea aurea] Length = 628 Score = 63.5 bits (153), Expect = 3e-08 Identities = 24/35 (68%), Positives = 32/35 (91%) Frame = +3 Query: 3 FVKRVSKTVDRLFMVRDATRFHHFQNGTCSCNDYW 107 FVK VS+ ++R F+VRD+TRFHHF++G+CSCNDYW Sbjct: 594 FVKEVSRFIERRFVVRDSTRFHHFRHGSCSCNDYW 628 >ref|XP_004305658.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460-like [Fragaria vesca subsp. vesca] Length = 608 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +3 Query: 3 FVKRVSKTVDRLFMVRDATRFHHFQNGTCSCNDYW 107 F+K +SK V R F+VRDATRFHHF+NG CSC DYW Sbjct: 574 FIKSISKIVQRQFVVRDATRFHHFRNGICSCKDYW 608 >gb|ESW16837.1| hypothetical protein PHAVU_007G188900g [Phaseolus vulgaris] Length = 626 Score = 62.4 bits (150), Expect = 8e-08 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +3 Query: 3 FVKRVSKTVDRLFMVRDATRFHHFQNGTCSCNDYW 107 F+K VSK V+R F+VRDATRFHHF++G CSC DYW Sbjct: 592 FIKLVSKIVNRQFIVRDATRFHHFRDGVCSCKDYW 626 >ref|XP_003537073.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460-like [Glycine max] Length = 630 Score = 62.0 bits (149), Expect = 1e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +3 Query: 3 FVKRVSKTVDRLFMVRDATRFHHFQNGTCSCNDYW 107 F+K VSK V+R F+VRDATRFHHF++G CSC DYW Sbjct: 596 FIKLVSKIVNRQFIVRDATRFHHFRDGICSCKDYW 630 >gb|EMJ04957.1| hypothetical protein PRUPE_ppa003558mg [Prunus persica] Length = 566 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +3 Query: 6 VKRVSKTVDRLFMVRDATRFHHFQNGTCSCNDYW 107 ++ VSK VDR F+VRDATRFHHF+NG CSC DYW Sbjct: 533 LRLVSKIVDRQFVVRDATRFHHFRNGICSCKDYW 566 >ref|XP_002276416.2| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460-like [Vitis vinifera] Length = 629 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +3 Query: 3 FVKRVSKTVDRLFMVRDATRFHHFQNGTCSCNDYW 107 F+K VS+ VDR +VRDATRFHHF+NG CSC DYW Sbjct: 595 FLKLVSEIVDRQLVVRDATRFHHFKNGVCSCKDYW 629 >emb|CBI30310.3| unnamed protein product [Vitis vinifera] Length = 543 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +3 Query: 3 FVKRVSKTVDRLFMVRDATRFHHFQNGTCSCNDYW 107 F+K VS+ VDR +VRDATRFHHF+NG CSC DYW Sbjct: 509 FLKLVSEIVDRQLVVRDATRFHHFKNGVCSCKDYW 543 >gb|EOY08282.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 610 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +3 Query: 3 FVKRVSKTVDRLFMVRDATRFHHFQNGTCSCNDYW 107 F+K VSK VDR +VRDATRFHHF++G CSC DYW Sbjct: 576 FLKGVSKIVDRQLVVRDATRFHHFRDGLCSCKDYW 610 >ref|NP_187753.1| mitochondrial RNA editing factor 10 [Arabidopsis thaliana] gi|75169981|sp|Q9CAY1.1|PP223_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At3g11460 gi|12322902|gb|AAG51440.1|AC008153_13 hypothetical protein; 50785-52656 [Arabidopsis thaliana] gi|332641528|gb|AEE75049.1| mitochondrial RNA editing factor 10 [Arabidopsis thaliana] Length = 623 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = +3 Query: 3 FVKRVSKTVDRLFMVRDATRFHHFQNGTCSCNDYW 107 F+K+VSK VDR F+VRDA+RFH+F++G CSC DYW Sbjct: 589 FLKQVSKIVDRQFVVRDASRFHYFKDGVCSCKDYW 623 >ref|XP_006395522.1| hypothetical protein EUTSA_v10003772mg [Eutrema salsugineum] gi|557092161|gb|ESQ32808.1| hypothetical protein EUTSA_v10003772mg [Eutrema salsugineum] Length = 664 Score = 60.5 bits (145), Expect = 3e-07 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +3 Query: 6 VKRVSKTVDRLFMVRDATRFHHFQNGTCSCNDYW 107 +K +SK VDR F+VRDA RFHHF+NG CSC DYW Sbjct: 631 IKLISKIVDREFVVRDAKRFHHFKNGLCSCGDYW 664 >ref|XP_002882733.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297328573|gb|EFH58992.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 620 Score = 60.5 bits (145), Expect = 3e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +3 Query: 3 FVKRVSKTVDRLFMVRDATRFHHFQNGTCSCNDYW 107 F+K VSK VDR F+VRDA+RFH+F++G CSC DYW Sbjct: 586 FIKLVSKIVDRRFVVRDASRFHYFKDGVCSCKDYW 620 >ref|XP_006407445.1| hypothetical protein EUTSA_v10022435mg [Eutrema salsugineum] gi|557108591|gb|ESQ48898.1| hypothetical protein EUTSA_v10022435mg [Eutrema salsugineum] Length = 625 Score = 60.1 bits (144), Expect = 4e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +3 Query: 3 FVKRVSKTVDRLFMVRDATRFHHFQNGTCSCNDYW 107 F+K VSK VDR F+VRDA+RFH+F++G CSC DYW Sbjct: 591 FIKMVSKIVDRRFVVRDASRFHYFKDGFCSCKDYW 625 >ref|XP_004156253.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460-like [Cucumis sativus] Length = 614 Score = 59.7 bits (143), Expect = 5e-07 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = +3 Query: 3 FVKRVSKTVDRLFMVRDATRFHHFQNGTCSCNDYW 107 F K VSK V R VRDATRFHHF+NG+CSC DYW Sbjct: 580 FFKMVSKIVHRQLTVRDATRFHHFRNGSCSCKDYW 614 >ref|XP_004143385.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460-like [Cucumis sativus] Length = 623 Score = 59.7 bits (143), Expect = 5e-07 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = +3 Query: 3 FVKRVSKTVDRLFMVRDATRFHHFQNGTCSCNDYW 107 F K VSK V R VRDATRFHHF+NG+CSC DYW Sbjct: 589 FFKMVSKIVHRQLTVRDATRFHHFRNGSCSCKDYW 623