BLASTX nr result
ID: Atropa21_contig00038820
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00038820 (781 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI33546.3| unnamed protein product [Vitis vinifera] 53 2e-07 ref|XP_003633718.1| PREDICTED: uncharacterized protein LOC100243... 53 2e-07 >emb|CBI33546.3| unnamed protein product [Vitis vinifera] Length = 183 Score = 53.1 bits (126), Expect(2) = 2e-07 Identities = 21/34 (61%), Positives = 28/34 (82%) Frame = -1 Query: 406 DENALWKRAIIKGEKCRPSKFSGKISYDANGNLV 305 D+ A+WKR I+ GE+CRP FSGKI+YD+ GNL+ Sbjct: 132 DDEAVWKRTIMMGERCRPLDFSGKIAYDSQGNLL 165 Score = 29.3 bits (64), Expect(2) = 2e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -3 Query: 491 KALLMVKMISWRK 453 KALLMVKM+SWRK Sbjct: 104 KALLMVKMVSWRK 116 >ref|XP_003633718.1| PREDICTED: uncharacterized protein LOC100243237 [Vitis vinifera] Length = 154 Score = 53.1 bits (126), Expect(2) = 2e-07 Identities = 21/34 (61%), Positives = 28/34 (82%) Frame = -1 Query: 406 DENALWKRAIIKGEKCRPSKFSGKISYDANGNLV 305 D+ A+WKR I+ GE+CRP FSGKI+YD+ GNL+ Sbjct: 103 DDEAVWKRTIMMGERCRPLDFSGKIAYDSQGNLL 136 Score = 29.3 bits (64), Expect(2) = 2e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -3 Query: 491 KALLMVKMISWRK 453 KALLMVKM+SWRK Sbjct: 75 KALLMVKMVSWRK 87