BLASTX nr result
ID: Atropa21_contig00038560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00038560 (496 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004245433.1| PREDICTED: uncharacterized mitochondrial pro... 62 1e-07 >ref|XP_004245433.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like [Solanum lycopersicum] Length = 266 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +3 Query: 369 KHTLDLLSEFDVSHLGSVSSPLDPSSKLIVDSGTSLNDPNIY 494 K+ LDLL+EFD+SHL SVSSP+DPS KL DSG ++DP IY Sbjct: 87 KYILDLLAEFDISHLHSVSSPMDPSCKLTADSGKLMSDPTIY 128