BLASTX nr result
ID: Atropa21_contig00038545
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00038545 (479 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004246003.1| PREDICTED: jmjC domain-containing protein 7-... 76 5e-12 >ref|XP_004246003.1| PREDICTED: jmjC domain-containing protein 7-like [Solanum lycopersicum] Length = 377 Score = 75.9 bits (185), Expect = 5e-12 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +2 Query: 2 WYDMRFDIKYAYFNFLQSLPHSMLCNPSSSGKLGMESRYN 121 WYDMRFDIKYAYFNFLQ LPH +LCNP+SS KLG+ES++N Sbjct: 306 WYDMRFDIKYAYFNFLQLLPHPILCNPASSEKLGLESQHN 345