BLASTX nr result
ID: Atropa21_contig00037668
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00037668 (657 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006351939.1| PREDICTED: uncharacterized protein LOC102581... 51 2e-06 >ref|XP_006351939.1| PREDICTED: uncharacterized protein LOC102581206 [Solanum tuberosum] Length = 307 Score = 50.8 bits (120), Expect(2) = 2e-06 Identities = 27/76 (35%), Positives = 39/76 (51%), Gaps = 3/76 (3%) Frame = -2 Query: 635 MTWEHFISFCFWHIRLARNNNLFNNKKDIASTSNVIAKALEAL---HIIASGRIDKPSVI 465 ++WE + F WHI L RNNN+F+N S VIA+ LE ++S DK + Sbjct: 78 LSWEIYFPFAIWHIWLNRNNNIFHNSNSPISIPTVIARTLEYAFTGKFLSSTPSDK--IT 135 Query: 464 INLKWNSPNKNTFSLN 417 I+ +W P + LN Sbjct: 136 IHARWKPPPHGLYKLN 151 Score = 26.9 bits (58), Expect(2) = 2e-06 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -1 Query: 390 IGGFGGVIRNSRADWVIGF 334 +GG GGV R+ +W +GF Sbjct: 162 VGGLGGVFRDEYGNWKMGF 180