BLASTX nr result
ID: Atropa21_contig00037661
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00037661 (541 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC05636.1| putative protein [Arabidopsis thaliana] 59 6e-07 >emb|CAC05636.1| putative protein [Arabidopsis thaliana] Length = 221 Score = 59.3 bits (142), Expect = 6e-07 Identities = 26/47 (55%), Positives = 33/47 (70%) Frame = +1 Query: 400 LIRLSKVEFPRFNGKGFQDWWYRVE*FFSLDEIQPHQKITIASIHFD 540 L RL KV+FPRFNG G +DW +++E FF +D K+ IASIHFD Sbjct: 63 LRRLGKVDFPRFNGDGIKDWLFQIEQFFLIDHTPEELKVDIASIHFD 109