BLASTX nr result
ID: Atropa21_contig00037618
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00037618 (577 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006359388.1| PREDICTED: thiamine pyrophosphokinase 2-like... 57 3e-06 >ref|XP_006359388.1| PREDICTED: thiamine pyrophosphokinase 2-like isoform X1 [Solanum tuberosum] Length = 279 Score = 57.0 bits (136), Expect = 3e-06 Identities = 32/46 (69%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = -2 Query: 135 FLNNGGDLDDG-RKLASMGLISHSSTFLLPNLPTTDNGPALTYALV 1 F N + G RKLA+M L SHSSTFLLPNLP TD+GPALTYALV Sbjct: 7 FFNLSNRISRGVRKLATMSLTSHSSTFLLPNLP-TDDGPALTYALV 51