BLASTX nr result
ID: Atropa21_contig00037227
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00037227 (543 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB42392.1| hypothetical protein L484_021986 [Morus notabilis] 64 2e-08 >gb|EXB42392.1| hypothetical protein L484_021986 [Morus notabilis] Length = 73 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/66 (46%), Positives = 47/66 (71%) Frame = +1 Query: 346 DAMTIVMHVMLRKSISIYDELAYVLGDIFWILNSVVRFSGMFVSRRSNSISSRHYSPMSS 525 DA++++M+V+LRK+I I+ E A +L D +L S V+FSG+ R + +SSR+ SPMSS Sbjct: 7 DAVSMLMYVVLRKNIQIFSEFAALLVDFVSVLTSTVQFSGLLFRRTTTRVSSRYSSPMSS 66 Query: 526 MLVRLD 543 M+ R D Sbjct: 67 MIARHD 72