BLASTX nr result
ID: Atropa21_contig00036365
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00036365 (617 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN60433.1| hypothetical protein VITISV_020389 [Vitis vinifera] 54 5e-06 >emb|CAN60433.1| hypothetical protein VITISV_020389 [Vitis vinifera] Length = 1463 Score = 53.9 bits (128), Expect(2) = 5e-06 Identities = 25/61 (40%), Positives = 34/61 (55%), Gaps = 1/61 (1%) Frame = -3 Query: 363 WC-WTVNRFHVVGVWEHIRKFWPQLFTKLKVNKACDGR*ITFWEDPWLGHPPLKEKLPDL 187 WC W V + H VG+W+ IR W + T++ + +GR + FW D W G PL E P L Sbjct: 869 WCSWEVRKAHGVGLWKGIRMDWELVGTQISFSVG-NGRRVRFWRDRWCGDSPLCESFPSL 927 Query: 186 F 184 F Sbjct: 928 F 928 Score = 22.3 bits (46), Expect(2) = 5e-06 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = -2 Query: 100 LKECQPFLKELEDMQPLSNTPDSLIW 23 ++E + FLK L + L + D ++W Sbjct: 966 VEEAEIFLKRLHGKRVLEDVDDMVVW 991