BLASTX nr result
ID: Atropa21_contig00036028
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00036028 (568 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006356603.1| PREDICTED: putative ribonuclease H protein A... 58 3e-08 >ref|XP_006356603.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Solanum tuberosum] Length = 885 Score = 57.8 bits (138), Expect(2) = 3e-08 Identities = 33/74 (44%), Positives = 46/74 (62%), Gaps = 1/74 (1%) Frame = +3 Query: 87 P*SIAGWIEEIKQLEEGKHLVYTHMLREGNQLVDSLANHALDKGAV-SYGHFRDMKAGLR 263 P IA +EEI+++ E TH+ REGN L DSLAN A++ A Y F+++ R Sbjct: 792 PWKIAEKVEEIREIMEKIKAKITHIFREGNSLADSLANIAIESQAEHQYSCFQELPLKER 851 Query: 264 KILNNDKSQIPYIR 305 +ILN DK+QIP +R Sbjct: 852 RILNIDKAQIPTLR 865 Score = 25.8 bits (55), Expect(2) = 3e-08 Identities = 9/22 (40%), Positives = 18/22 (81%) Frame = +1 Query: 10 NKQMDKIIIQTDSQFIQRILTE 75 N++M K+II+TDS +++I+ + Sbjct: 766 NRKMQKVIIETDSLSLKKIIQQ 787