BLASTX nr result
ID: Atropa21_contig00035812
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00035812 (568 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004245615.1| PREDICTED: glutathione S-transferase T1-like... 70 4e-10 ref|XP_006343997.1| PREDICTED: glutathione S-transferase T1-like... 65 1e-08 ref|XP_006343998.1| PREDICTED: glutathione S-transferase T1-like... 62 8e-08 ref|XP_004245614.1| PREDICTED: glutathione S-transferase T1-like... 59 1e-06 >ref|XP_004245615.1| PREDICTED: glutathione S-transferase T1-like [Solanum lycopersicum] Length = 250 Score = 70.1 bits (170), Expect = 4e-10 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 567 DTKNAMEPHFHEVHKILFKFKEKLQKQRSARGSSTTELNRKPDLQAKM 424 DTKNAMEPHF EVH ILFK KEK KQR A GSS + +RKPDL +KM Sbjct: 203 DTKNAMEPHFQEVHVILFKAKEKFHKQRHAVGSSIPQSSRKPDLHSKM 250 >ref|XP_006343997.1| PREDICTED: glutathione S-transferase T1-like [Solanum tuberosum] Length = 250 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/48 (64%), Positives = 36/48 (75%) Frame = -2 Query: 567 DTKNAMEPHFHEVHKILFKFKEKLQKQRSARGSSTTELNRKPDLQAKM 424 DTKNAMEPHF EVH ILFK KEK Q+QR GSS + +RKP+ +KM Sbjct: 203 DTKNAMEPHFQEVHVILFKAKEKFQRQRYDVGSSIPQSSRKPEFHSKM 250 >ref|XP_006343998.1| PREDICTED: glutathione S-transferase T1-like isoform X1 [Solanum tuberosum] Length = 250 Score = 62.4 bits (150), Expect = 8e-08 Identities = 30/48 (62%), Positives = 35/48 (72%) Frame = -2 Query: 567 DTKNAMEPHFHEVHKILFKFKEKLQKQRSARGSSTTELNRKPDLQAKM 424 DTKNAM PHF EV L +KEK+QKQR+A GS T+ RKP LQ+KM Sbjct: 203 DTKNAMAPHFEEVQSTLSNYKEKVQKQRNAVGSKITQSGRKPVLQSKM 250 >ref|XP_004245614.1| PREDICTED: glutathione S-transferase T1-like [Solanum lycopersicum] Length = 250 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/48 (58%), Positives = 33/48 (68%) Frame = -2 Query: 567 DTKNAMEPHFHEVHKILFKFKEKLQKQRSARGSSTTELNRKPDLQAKM 424 DTKNAM PHF EV L +KEK+QKQR+ GS T+ RKP LQ+ M Sbjct: 203 DTKNAMAPHFEEVQSTLAGYKEKVQKQRNTLGSKITQSGRKPVLQSNM 250