BLASTX nr result
ID: Atropa21_contig00035455
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00035455 (510 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006363293.1| PREDICTED: uncharacterized protein At1g04910... 67 3e-09 ref|XP_004237944.1| PREDICTED: uncharacterized protein At1g04910... 67 3e-09 ref|XP_006360301.1| PREDICTED: uncharacterized protein At1g04910... 58 1e-06 >ref|XP_006363293.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum tuberosum] Length = 531 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 508 RFRSEEAFYVNPLPDCLCRKESSYTNNSHSIR 413 RFRSEEAFYVNPLPDCLCRKESSY NNS SIR Sbjct: 500 RFRSEEAFYVNPLPDCLCRKESSYMNNSQSIR 531 >ref|XP_004237944.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum lycopersicum] Length = 531 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 508 RFRSEEAFYVNPLPDCLCRKESSYTNNSHSIR 413 RFRSEEAFYVNPLPDCLCRKESSY NNS SIR Sbjct: 500 RFRSEEAFYVNPLPDCLCRKESSYMNNSQSIR 531 >ref|XP_006360301.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum tuberosum] Length = 619 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 508 RFRSEEAFYVNPLPDCLCRKESSYTNNSHSI 416 RFRSEEAFYVN LPDCLC++E +YTN+SH+I Sbjct: 496 RFRSEEAFYVNSLPDCLCQRELAYTNDSHAI 526