BLASTX nr result
ID: Atropa21_contig00035315
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00035315 (501 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004248997.1| PREDICTED: sugar transporter ERD6-like 8-lik... 54 3e-06 >ref|XP_004248997.1| PREDICTED: sugar transporter ERD6-like 8-like [Solanum lycopersicum] Length = 520 Score = 54.3 bits (129), Expect(2) = 3e-06 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 5/45 (11%) Frame = +2 Query: 335 LCIYSSFPIGMGVGPWLIMSELFPLHVRKG-----KTLMNLFGSW 454 L +SF IGMG GPWLIMSE+FPLH+ KG TL+N FGSW Sbjct: 424 LVYIASFSIGMGAGPWLIMSEVFPLHI-KGLGGGLVTLVNWFGSW 467 Score = 22.3 bits (46), Expect(2) = 3e-06 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +3 Query: 456 VISCTFNFLMSRSSH 500 VIS TFNFL+ S H Sbjct: 468 VISYTFNFLLLWSGH 482