BLASTX nr result
ID: Atropa21_contig00034615
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00034615 (632 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC33546.1| hypothetical protein L484_006110 [Morus notabilis] 63 8e-08 >gb|EXC33546.1| hypothetical protein L484_006110 [Morus notabilis] Length = 201 Score = 62.8 bits (151), Expect = 8e-08 Identities = 29/44 (65%), Positives = 32/44 (72%) Frame = +1 Query: 223 GQK*EGSKDGLVIHTFGLMNGGLADSDFHKLWQVLECLSRTLAH 354 GQK EG + GLVIHT G MNGG D FH+ W+VLECLSR L H Sbjct: 82 GQKGEGCEGGLVIHTSGRMNGGPTDPGFHERWRVLECLSRALVH 125