BLASTX nr result
ID: Atropa21_contig00032756
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00032756 (645 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006409346.1| hypothetical protein EUTSA_v10022536mg [Eutr... 57 6e-06 >ref|XP_006409346.1| hypothetical protein EUTSA_v10022536mg [Eutrema salsugineum] gi|557110508|gb|ESQ50799.1| hypothetical protein EUTSA_v10022536mg [Eutrema salsugineum] Length = 914 Score = 56.6 bits (135), Expect = 6e-06 Identities = 49/171 (28%), Positives = 73/171 (42%), Gaps = 19/171 (11%) Frame = -3 Query: 466 VAASLIQVLVGLYFPITNSASIISKDSLLQIWIPGSEDGRT-LSAMGSPHGIAYEKGSSS 290 V L+Q + GL + +++ KD L+QIW+P ++G+ L+ PH E S Sbjct: 128 VKKRLLQAISGL------NEAVVDKDFLVQIWVPFQQEGKNFLTTWAQPHLFNQEYSS-- 179 Query: 289 SHQLQLYREESGKYGTAKDM------------------ITHFSQFSNQTNYLHYEIAKDC 164 L YR S Y D T +F Y + A+ C Sbjct: 180 ---LAKYRHVSENYNFPADEGSKDVGLPGRVFLQKLPEWTPDVRFFRSDEYPRIKEAQKC 236 Query: 163 GIRGSKFLPVFVLSSRTQGPCIAVLELVTTRSDPDFGIEEYKEIKRELEVM 11 +RGS LPVF R G C+ V+E+VTT ++G E + I + LE + Sbjct: 237 DVRGSLALPVF---ERGSGTCLGVVEIVTTTQKMNYG-PELENICKALEAV 283