BLASTX nr result
ID: Atropa21_contig00032451
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00032451 (567 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006352543.1| PREDICTED: probable RNA polymerase II transc... 57 4e-06 ref|XP_004248296.1| PREDICTED: probable RNA polymerase II transc... 57 4e-06 >ref|XP_006352543.1| PREDICTED: probable RNA polymerase II transcription factor B subunit 1-1-like [Solanum tuberosum] Length = 599 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/31 (87%), Positives = 28/31 (90%), Gaps = 1/31 (3%) Frame = +3 Query: 45 QALLNLMQDQGG-YIFEFDSFPDRDQCRDFV 134 QALLNL Q QGG Y+FEFDSFPDRDQCRDFV Sbjct: 65 QALLNLTQAQGGNYLFEFDSFPDRDQCRDFV 95 >ref|XP_004248296.1| PREDICTED: probable RNA polymerase II transcription factor B subunit 1-1-like [Solanum lycopersicum] Length = 599 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/31 (87%), Positives = 28/31 (90%), Gaps = 1/31 (3%) Frame = +3 Query: 45 QALLNLMQDQGG-YIFEFDSFPDRDQCRDFV 134 QALLNL Q QGG Y+FEFDSFPDRDQCRDFV Sbjct: 65 QALLNLTQAQGGNYLFEFDSFPDRDQCRDFV 95