BLASTX nr result
ID: Atropa21_contig00031905
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00031905 (1081 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509827.1| conserved hypothetical protein [Ricinus comm... 59 4e-09 >ref|XP_002509827.1| conserved hypothetical protein [Ricinus communis] gi|223549726|gb|EEF51214.1| conserved hypothetical protein [Ricinus communis] Length = 208 Score = 58.5 bits (140), Expect(2) = 4e-09 Identities = 22/53 (41%), Positives = 40/53 (75%) Frame = +1 Query: 796 VPKIKFAFPEIDTNNPRGWIKRCERFFELYQVTSKQKIDIEAVHIKDQNDPWF 954 +PK++ + + NNPR WIK+CE++F+LY + ++QKIDI ++++ D+ D W+ Sbjct: 108 IPKVELS--HFEGNNPRLWIKKCEKYFQLYSIPNEQKIDIASLYLGDRADIWY 158 Score = 30.0 bits (66), Expect(2) = 4e-09 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +3 Query: 999 FCSDVCRRYENICPVDVVIEFNRLQQR 1079 F ++CRR+ + DVV EFN+L+Q+ Sbjct: 173 FSEELCRRFGELTIEDVVEEFNKLKQK 199