BLASTX nr result
ID: Atropa21_contig00031765
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00031765 (487 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006481708.1| PREDICTED: uncharacterized protein LOC102630... 44 4e-07 >ref|XP_006481708.1| PREDICTED: uncharacterized protein LOC102630771 [Citrus sinensis] Length = 62 Score = 43.5 bits (101), Expect(2) = 4e-07 Identities = 23/42 (54%), Positives = 28/42 (66%), Gaps = 4/42 (9%) Frame = +2 Query: 14 MVVWSYPPTLKQL----EFTLCGITLITAGAYLLGLNKPVQK 127 MVVWSYPPT KQL F + G++L TAGAYL +N Q+ Sbjct: 1 MVVWSYPPTRKQLAMSIAFFITGVSLFTAGAYLSLVNVAPQQ 42 Score = 36.2 bits (82), Expect(2) = 4e-07 Identities = 16/25 (64%), Positives = 20/25 (80%) Frame = +1 Query: 100 IGSQQASAKARKDYTKARLKQLLQD 174 + QQA AKARKD+ KARL++LL D Sbjct: 38 VAPQQARAKARKDFVKARLRKLLDD 62