BLASTX nr result
ID: Atropa21_contig00031749
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00031749 (458 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004229635.1| PREDICTED: tRNA-dihydrouridine synthase A-li... 89 6e-16 ref|XP_004229634.1| PREDICTED: tRNA-dihydrouridine synthase A-li... 87 2e-15 ref|XP_006345439.1| PREDICTED: tRNA-dihydrouridine(20a/20b) synt... 87 3e-15 ref|XP_006345440.1| PREDICTED: tRNA-dihydrouridine(20a/20b) synt... 84 1e-14 ref|XP_002298425.2| hypothetical protein POPTR_0001s27210g [Popu... 56 4e-06 gb|EOX96665.1| FMN-linked oxidoreductases superfamily protein is... 55 1e-05 gb|EOX96664.1| FMN-linked oxidoreductases superfamily protein is... 55 1e-05 ref|XP_002517816.1| tRNA-dihydrouridine synthase A, putative [Ri... 55 1e-05 >ref|XP_004229635.1| PREDICTED: tRNA-dihydrouridine synthase A-like [Solanum lycopersicum] Length = 439 Score = 89.0 bits (219), Expect = 6e-16 Identities = 44/48 (91%), Positives = 45/48 (93%) Frame = +1 Query: 1 EETLGEIPDRVLDAHITEVPSGSTDTFIKAKSLLPPPYTVNEEELEHA 144 EETLGEIPD VLDA ITEVPSGSTDTFIKAKSLLPPPYTVNEEEL +A Sbjct: 392 EETLGEIPDEVLDAPITEVPSGSTDTFIKAKSLLPPPYTVNEEELLYA 439 >ref|XP_004229634.1| PREDICTED: tRNA-dihydrouridine synthase A-like [Solanum lycopersicum] Length = 372 Score = 87.0 bits (214), Expect = 2e-15 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = +1 Query: 1 EETLGEIPDRVLDAHITEVPSGSTDTFIKAKSLLPPPYTVNEEEL 135 EETLGEIPDRVLDA +TEVPSGSTDTFIKAKSLLPPPYTV+EEEL Sbjct: 327 EETLGEIPDRVLDAPLTEVPSGSTDTFIKAKSLLPPPYTVSEEEL 371 >ref|XP_006345439.1| PREDICTED: tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like [Solanum tuberosum] Length = 427 Score = 86.7 bits (213), Expect = 3e-15 Identities = 43/48 (89%), Positives = 44/48 (91%) Frame = +1 Query: 1 EETLGEIPDRVLDAHITEVPSGSTDTFIKAKSLLPPPYTVNEEELEHA 144 EETLGEIPD VLDA ITEVPSG TDTFIKAKSLLPPPYTVNEEEL +A Sbjct: 380 EETLGEIPDEVLDAPITEVPSGITDTFIKAKSLLPPPYTVNEEELLYA 427 >ref|XP_006345440.1| PREDICTED: tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like [Solanum tuberosum] Length = 372 Score = 84.3 bits (207), Expect = 1e-14 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = +1 Query: 1 EETLGEIPDRVLDAHITEVPSGSTDTFIKAKSLLPPPYTVNEEEL 135 EETLGEIPDRVLDA +TE+PSGS+DTFIKAKSLLPPPYTV+EEEL Sbjct: 327 EETLGEIPDRVLDAPLTEMPSGSSDTFIKAKSLLPPPYTVSEEEL 371 >ref|XP_002298425.2| hypothetical protein POPTR_0001s27210g [Populus trichocarpa] gi|550348297|gb|EEE83230.2| hypothetical protein POPTR_0001s27210g [Populus trichocarpa] Length = 493 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/45 (55%), Positives = 30/45 (66%) Frame = +1 Query: 1 EETLGEIPDRVLDAHITEVPSGSTDTFIKAKSLLPPPYTVNEEEL 135 EETL IPD VLD+H E+PSG D F + LLPPPY E+E+ Sbjct: 445 EETLVAIPDAVLDSHAAELPSGRKDLFANVRGLLPPPYETREQEV 489 >gb|EOX96665.1| FMN-linked oxidoreductases superfamily protein isoform 2 [Theobroma cacao] gi|508704770|gb|EOX96666.1| FMN-linked oxidoreductases superfamily protein isoform 2 [Theobroma cacao] Length = 375 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/48 (56%), Positives = 31/48 (64%) Frame = +1 Query: 1 EETLGEIPDRVLDAHITEVPSGSTDTFIKAKSLLPPPYTVNEEELEHA 144 EETL IPD VLD+ I VPSG D F + LLPPPY V E+E +A Sbjct: 328 EETLVAIPDSVLDSPIAGVPSGHEDLFANVQGLLPPPYNVREQEAVYA 375 >gb|EOX96664.1| FMN-linked oxidoreductases superfamily protein isoform 1 [Theobroma cacao] Length = 436 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/48 (56%), Positives = 31/48 (64%) Frame = +1 Query: 1 EETLGEIPDRVLDAHITEVPSGSTDTFIKAKSLLPPPYTVNEEELEHA 144 EETL IPD VLD+ I VPSG D F + LLPPPY V E+E +A Sbjct: 389 EETLVAIPDSVLDSPIAGVPSGHEDLFANVQGLLPPPYNVREQEAVYA 436 >ref|XP_002517816.1| tRNA-dihydrouridine synthase A, putative [Ricinus communis] gi|223543088|gb|EEF44623.1| tRNA-dihydrouridine synthase A, putative [Ricinus communis] Length = 375 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/48 (52%), Positives = 31/48 (64%) Frame = +1 Query: 1 EETLGEIPDRVLDAHITEVPSGSTDTFIKAKSLLPPPYTVNEEELEHA 144 EETL IPD VLD+ I E PSG D F + LLPPPY E+++ +A Sbjct: 328 EETLVAIPDTVLDSPIAEAPSGRQDLFTNVRGLLPPPYATREQDVAYA 375