BLASTX nr result
ID: Atropa21_contig00031541
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00031541 (615 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006362608.1| PREDICTED: transcription initiation factor T... 78 4e-21 ref|XP_002321800.1| hypothetical protein POPTR_0015s15700g [Popu... 52 7e-06 >ref|XP_006362608.1| PREDICTED: transcription initiation factor TFIID subunit 8-like [Solanum tuberosum] Length = 271 Score = 77.8 bits (190), Expect(3) = 4e-21 Identities = 42/67 (62%), Positives = 50/67 (74%), Gaps = 2/67 (2%) Frame = -3 Query: 448 MRS*SKCNRPLAT--IPPPSTASTESDYAFTLTKIAVAKICSSIGFAAAETPVLRILSKV 275 M S S NRPLA IPPPST +ESDYAFT+T+ AVA+ICSSIGF AAE PVL IL+ + Sbjct: 1 MSSKSNRNRPLAAKAIPPPSTPLSESDYAFTITRTAVAQICSSIGFTAAEAPVLGILTDI 60 Query: 274 STMCLRS 254 + LR+ Sbjct: 61 AVRYLRT 67 Score = 41.6 bits (96), Expect(3) = 4e-21 Identities = 19/30 (63%), Positives = 24/30 (80%) Frame = -2 Query: 251 NSVNSTGRMQSNLVNTVAVVEELSFVSGFP 162 +S NS R Q+NLV+T+A V+ELS VSGFP Sbjct: 74 DSANSASRTQANLVDTIAAVDELSSVSGFP 103 Score = 28.1 bits (61), Expect(3) = 4e-21 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -1 Query: 165 PEAWSATGSFLNSGFV 118 P AW ATG FLNSG V Sbjct: 103 PGAWRATGCFLNSGAV 118 >ref|XP_002321800.1| hypothetical protein POPTR_0015s15700g [Populus trichocarpa] gi|222868796|gb|EEF05927.1| hypothetical protein POPTR_0015s15700g [Populus trichocarpa] Length = 267 Score = 52.0 bits (123), Expect(2) = 7e-06 Identities = 22/51 (43%), Positives = 34/51 (66%) Frame = -3 Query: 406 PPPSTASTESDYAFTLTKIAVAKICSSIGFAAAETPVLRILSKVSTMCLRS 254 PPP A SDYAF +TK AV++IC S+GF + + L L+ ++T+ L++ Sbjct: 26 PPPPLAENPSDYAFKITKTAVSQICQSVGFKSTQLSALETLTHIATLYLQT 76 Score = 23.9 bits (50), Expect(2) = 7e-06 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = -2 Query: 242 NSTGRMQSNLVNTVAVVEELSFVSGF 165 N++ R QSN+ + + + ++S V GF Sbjct: 86 NASNRTQSNIFDIINSLHDMSSVQGF 111