BLASTX nr result
ID: Atropa21_contig00031529
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00031529 (488 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB38542.1| Formin-like protein 20 [Morus notabilis] 70 4e-10 ref|XP_006601434.1| PREDICTED: formin-like protein 20-like [Glyc... 70 4e-10 ref|XP_006494990.1| PREDICTED: formin-like protein 20-like [Citr... 70 4e-10 ref|XP_006354826.1| PREDICTED: formin-like protein 20-like [Sola... 70 4e-10 ref|XP_006345218.1| PREDICTED: formin-like protein 20-like [Sola... 70 4e-10 gb|ESW27274.1| hypothetical protein PHAVU_003G1878001g, partial ... 70 4e-10 ref|XP_006440663.1| hypothetical protein CICLE_v100188771mg, par... 70 4e-10 ref|XP_006376809.1| hypothetical protein POPTR_0012s069802g, par... 70 4e-10 ref|XP_006374444.1| hypothetical protein POPTR_0015s072201g, par... 70 4e-10 gb|EOY21944.1| Actin-binding FH2 protein isoform 4 [Theobroma ca... 70 4e-10 gb|EOY21943.1| Actin-binding FH2 protein isoform 3 [Theobroma ca... 70 4e-10 gb|EOY21942.1| Actin-binding FH2 protein isoform 2 [Theobroma ca... 70 4e-10 gb|EOY21941.1| Actin-binding FH2 protein isoform 1 [Theobroma ca... 70 4e-10 ref|XP_004301134.1| PREDICTED: formin-like protein 20-like [Frag... 70 4e-10 ref|XP_004242177.1| PREDICTED: formin-like protein 20-like [Sola... 70 4e-10 ref|XP_004236482.1| PREDICTED: formin-like protein 5-like [Solan... 70 4e-10 ref|XP_004173291.1| PREDICTED: formin-like protein 20-like [Cucu... 70 4e-10 ref|XP_004138306.1| PREDICTED: formin-like protein 20-like [Cucu... 70 4e-10 ref|XP_002281720.2| PREDICTED: formin-like protein 6-like [Vitis... 70 4e-10 ref|XP_006580638.1| PREDICTED: formin-like protein 20-like [Glyc... 70 4e-10 >gb|EXB38542.1| Formin-like protein 20 [Morus notabilis] Length = 1490 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 394 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 486 MALFRRFFYRKPPDRLLEISERVYVFDCCFS Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 31 >ref|XP_006601434.1| PREDICTED: formin-like protein 20-like [Glycine max] Length = 1436 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 394 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 486 MALFRRFFYRKPPDRLLEISERVYVFDCCFS Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 31 >ref|XP_006494990.1| PREDICTED: formin-like protein 20-like [Citrus sinensis] Length = 1393 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 394 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 486 MALFRRFFYRKPPDRLLEISERVYVFDCCFS Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 31 >ref|XP_006354826.1| PREDICTED: formin-like protein 20-like [Solanum tuberosum] Length = 1546 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 394 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 486 MALFRRFFYRKPPDRLLEISERVYVFDCCFS Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 31 >ref|XP_006345218.1| PREDICTED: formin-like protein 20-like [Solanum tuberosum] Length = 1776 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 394 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 486 MALFRRFFYRKPPDRLLEISERVYVFDCCFS Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 31 >gb|ESW27274.1| hypothetical protein PHAVU_003G1878001g, partial [Phaseolus vulgaris] Length = 747 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 394 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 486 MALFRRFFYRKPPDRLLEISERVYVFDCCFS Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 31 >ref|XP_006440663.1| hypothetical protein CICLE_v100188771mg, partial [Citrus clementina] gi|557542925|gb|ESR53903.1| hypothetical protein CICLE_v100188771mg, partial [Citrus clementina] Length = 526 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 394 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 486 MALFRRFFYRKPPDRLLEISERVYVFDCCFS Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 31 >ref|XP_006376809.1| hypothetical protein POPTR_0012s069802g, partial [Populus trichocarpa] gi|566197152|ref|XP_006376810.1| hypothetical protein POPTR_0012s069802g, partial [Populus trichocarpa] gi|550326538|gb|ERP54606.1| hypothetical protein POPTR_0012s069802g, partial [Populus trichocarpa] gi|550326539|gb|ERP54607.1| hypothetical protein POPTR_0012s069802g, partial [Populus trichocarpa] Length = 1004 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 394 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 486 MALFRRFFYRKPPDRLLEISERVYVFDCCFS Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 31 >ref|XP_006374444.1| hypothetical protein POPTR_0015s072201g, partial [Populus trichocarpa] gi|550322208|gb|ERP52241.1| hypothetical protein POPTR_0015s072201g, partial [Populus trichocarpa] Length = 725 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 394 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 486 MALFRRFFYRKPPDRLLEISERVYVFDCCFS Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 31 >gb|EOY21944.1| Actin-binding FH2 protein isoform 4 [Theobroma cacao] Length = 1069 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 394 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 486 MALFRRFFYRKPPDRLLEISERVYVFDCCFS Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 31 >gb|EOY21943.1| Actin-binding FH2 protein isoform 3 [Theobroma cacao] Length = 1213 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 394 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 486 MALFRRFFYRKPPDRLLEISERVYVFDCCFS Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 31 >gb|EOY21942.1| Actin-binding FH2 protein isoform 2 [Theobroma cacao] Length = 1408 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 394 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 486 MALFRRFFYRKPPDRLLEISERVYVFDCCFS Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 31 >gb|EOY21941.1| Actin-binding FH2 protein isoform 1 [Theobroma cacao] Length = 1438 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 394 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 486 MALFRRFFYRKPPDRLLEISERVYVFDCCFS Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 31 >ref|XP_004301134.1| PREDICTED: formin-like protein 20-like [Fragaria vesca subsp. vesca] Length = 1501 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 394 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 486 MALFRRFFYRKPPDRLLEISERVYVFDCCFS Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 31 >ref|XP_004242177.1| PREDICTED: formin-like protein 20-like [Solanum lycopersicum] Length = 1780 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 394 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 486 MALFRRFFYRKPPDRLLEISERVYVFDCCFS Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 31 >ref|XP_004236482.1| PREDICTED: formin-like protein 5-like [Solanum lycopersicum] Length = 1547 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 394 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 486 MALFRRFFYRKPPDRLLEISERVYVFDCCFS Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 31 >ref|XP_004173291.1| PREDICTED: formin-like protein 20-like [Cucumis sativus] Length = 715 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 394 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 486 MALFRRFFYRKPPDRLLEISERVYVFDCCFS Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 31 >ref|XP_004138306.1| PREDICTED: formin-like protein 20-like [Cucumis sativus] Length = 1275 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 394 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 486 MALFRRFFYRKPPDRLLEISERVYVFDCCFS Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 31 >ref|XP_002281720.2| PREDICTED: formin-like protein 6-like [Vitis vinifera] Length = 1498 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 394 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 486 MALFRRFFYRKPPDRLLEISERVYVFDCCFS Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 31 >ref|XP_006580638.1| PREDICTED: formin-like protein 20-like [Glycine max] Length = 1207 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 394 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 486 MALFRRFFYRKPPDRLLEISERVYVFDCCFS Sbjct: 1 MALFRRFFYRKPPDRLLEISERVYVFDCCFS 31