BLASTX nr result
ID: Atropa21_contig00030089
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00030089 (534 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006350337.1| PREDICTED: transcription factor TCP8-like [S... 99 6e-19 ref|NP_001233806.1| TCP transcription factor 12 [Solanum lycoper... 84 2e-14 >ref|XP_006350337.1| PREDICTED: transcription factor TCP8-like [Solanum tuberosum] Length = 389 Score = 99.0 bits (245), Expect = 6e-19 Identities = 52/72 (72%), Positives = 57/72 (79%), Gaps = 6/72 (8%) Frame = +2 Query: 335 MEFMEPHRKKQGGASTSSGTDHH----HHQETPSSLQLVSPHQSQPDLS--NHPHPHGPF 496 MEFMEPHRKKQGG++ S T+HH H+QE PSSLQL+SPHQSQPD S HPHGPF Sbjct: 1 MEFMEPHRKKQGGST--SATNHHQHHQHNQEAPSSLQLISPHQSQPDPSTPGSNHPHGPF 58 Query: 497 MGSISMQSRTLI 532 MGSISMQS TLI Sbjct: 59 MGSISMQSTTLI 70 >ref|NP_001233806.1| TCP transcription factor 12 [Solanum lycopersicum] gi|306416835|gb|ADM87261.1| TCP transcription factor 12 [Solanum lycopersicum] Length = 374 Score = 84.3 bits (207), Expect = 2e-14 Identities = 45/66 (68%), Positives = 48/66 (72%), Gaps = 4/66 (6%) Frame = +2 Query: 335 MEFMEPHRKKQGGASTSSGTDHHHH--QETPSSLQLVSPHQSQ--PDLSNHPHPHGPFMG 502 MEFMEPHRKK G AS +HH H +ETPSSLQL+SPHQSQ P HPHGPFMG Sbjct: 1 MEFMEPHRKKLGDAS-----NHHQHNQEETPSSLQLISPHQSQRDPSTPGSNHPHGPFMG 55 Query: 503 SISMQS 520 SISMQS Sbjct: 56 SISMQS 61