BLASTX nr result
ID: Atropa21_contig00030023
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00030023 (532 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001239047.1| calcineurin B-like 1 [Solanum lycopersicum] ... 140 1e-31 ref|XP_006362481.1| PREDICTED: calcineurin B-like protein 1-like... 132 6e-29 ref|XP_004244554.1| PREDICTED: calcineurin B-like protein 1-like... 132 6e-29 ref|NP_001267901.1| calcineurin B-like protein 01 [Vitis vinifer... 131 1e-28 gb|EXC26767.1| hypothetical protein L484_023383 [Morus notabilis] 130 2e-28 gb|ABW06388.1| CBL1 [Gossypium hirsutum] 129 3e-28 ref|XP_006361193.1| PREDICTED: calcineurin B-like protein 1-like... 129 5e-28 gb|EOY24156.1| Calcineurin B-like protein 1 isoform 1 [Theobroma... 129 5e-28 ref|XP_004164617.1| PREDICTED: calcineurin B-like protein 1-like... 128 7e-28 ref|XP_004147242.1| PREDICTED: calcineurin B-like protein 1-like... 128 7e-28 ref|XP_006284521.1| hypothetical protein CARUB_v10005722mg [Caps... 127 2e-27 ref|NP_974566.1| calcineurin B-like protein 1 [Arabidopsis thali... 127 2e-27 ref|NP_567533.1| calcineurin B-like protein 1 [Arabidopsis thali... 127 2e-27 gb|AHA98342.1| calcineurin B-like protein [Pyrus betulifolia] gi... 127 2e-27 ref|XP_002329597.1| predicted protein [Populus trichocarpa] gi|1... 127 2e-27 ref|XP_004148365.1| PREDICTED: calcineurin B-like protein 1-like... 126 3e-27 ref|XP_006477069.1| PREDICTED: calcineurin B-like protein 1-like... 126 3e-27 ref|XP_006440156.1| hypothetical protein CICLE_v10022219mg [Citr... 126 3e-27 ref|XP_004242278.1| PREDICTED: calcineurin B-like protein 1-like... 126 3e-27 gb|EPS61218.1| hypothetical protein M569_13582 [Genlisea aurea] 125 5e-27 >ref|NP_001239047.1| calcineurin B-like 1 [Solanum lycopersicum] gi|353523402|dbj|BAL04561.1| calcineurin B-like molecule [Solanum lycopersicum] Length = 213 Score = 140 bits (354), Expect = 1e-31 Identities = 69/72 (95%), Positives = 71/72 (98%) Frame = -1 Query: 532 MKLADETIEAILDKTFVEADSNQDGKIDKSEWQIFVGRNPSLLKIMTLPYLRDITTTFPS 353 MKLADETIE+ILDKTFVEADSNQDGKIDKSEWQIFV +NPSLLKIMTLPYLRDITTTFPS Sbjct: 142 MKLADETIESILDKTFVEADSNQDGKIDKSEWQIFVSQNPSLLKIMTLPYLRDITTTFPS 201 Query: 352 FVFHSEVDEVAT 317 FVFHSEVDEVAT Sbjct: 202 FVFHSEVDEVAT 213 >ref|XP_006362481.1| PREDICTED: calcineurin B-like protein 1-like [Solanum tuberosum] Length = 215 Score = 132 bits (331), Expect = 6e-29 Identities = 65/72 (90%), Positives = 67/72 (93%) Frame = -1 Query: 532 MKLADETIEAILDKTFVEADSNQDGKIDKSEWQIFVGRNPSLLKIMTLPYLRDITTTFPS 353 MKLADETIE ILDKTF EADSNQDGKIDKSEW+ FV RNPSLLKIMTLPYLRD+TTTFPS Sbjct: 144 MKLADETIEIILDKTFSEADSNQDGKIDKSEWRSFVDRNPSLLKIMTLPYLRDVTTTFPS 203 Query: 352 FVFHSEVDEVAT 317 FVFHSEVDE AT Sbjct: 204 FVFHSEVDEGAT 215 >ref|XP_004244554.1| PREDICTED: calcineurin B-like protein 1-like [Solanum lycopersicum] Length = 215 Score = 132 bits (331), Expect = 6e-29 Identities = 65/72 (90%), Positives = 67/72 (93%) Frame = -1 Query: 532 MKLADETIEAILDKTFVEADSNQDGKIDKSEWQIFVGRNPSLLKIMTLPYLRDITTTFPS 353 MKLADETIE ILDKTF EADSNQDGKIDKSEW+ FV RNPSLLKIMTLPYLRD+TTTFPS Sbjct: 144 MKLADETIEIILDKTFSEADSNQDGKIDKSEWRSFVDRNPSLLKIMTLPYLRDVTTTFPS 203 Query: 352 FVFHSEVDEVAT 317 FVFHSEVDE AT Sbjct: 204 FVFHSEVDEGAT 215 >ref|NP_001267901.1| calcineurin B-like protein 01 [Vitis vinifera] gi|359474415|ref|XP_002275887.2| PREDICTED: calcineurin B-like protein 1-like [Vitis vinifera] gi|229609879|gb|ACQ83555.1| calcineurin B-like protein 01 [Vitis vinifera] gi|296083437|emb|CBI23390.3| unnamed protein product [Vitis vinifera] gi|296083439|emb|CBI23392.3| unnamed protein product [Vitis vinifera] gi|310913176|emb|CBW30483.1| calcineurin B-like protein 01 [Vitis vinifera] Length = 213 Score = 131 bits (329), Expect = 1e-28 Identities = 64/72 (88%), Positives = 68/72 (94%) Frame = -1 Query: 532 MKLADETIEAILDKTFVEADSNQDGKIDKSEWQIFVGRNPSLLKIMTLPYLRDITTTFPS 353 MKLADETIE ILDKTF+EAD NQDG+IDKSEWQ FV RNPSLLKIMTLPYLRDITTTFPS Sbjct: 142 MKLADETIEIILDKTFLEADVNQDGRIDKSEWQNFVSRNPSLLKIMTLPYLRDITTTFPS 201 Query: 352 FVFHSEVDEVAT 317 FVF+SEVDE+AT Sbjct: 202 FVFNSEVDEIAT 213 >gb|EXC26767.1| hypothetical protein L484_023383 [Morus notabilis] Length = 278 Score = 130 bits (326), Expect = 2e-28 Identities = 63/72 (87%), Positives = 68/72 (94%) Frame = -1 Query: 532 MKLADETIEAILDKTFVEADSNQDGKIDKSEWQIFVGRNPSLLKIMTLPYLRDITTTFPS 353 MKLADETIE ILDKTF+EAD NQDGKIDK+EWQ FV +NPSLLKIMTLPYLRDITTTFPS Sbjct: 207 MKLADETIEIILDKTFMEADVNQDGKIDKTEWQNFVSKNPSLLKIMTLPYLRDITTTFPS 266 Query: 352 FVFHSEVDEVAT 317 FVF+SEVDE+AT Sbjct: 267 FVFNSEVDEIAT 278 >gb|ABW06388.1| CBL1 [Gossypium hirsutum] Length = 213 Score = 129 bits (325), Expect = 3e-28 Identities = 64/72 (88%), Positives = 67/72 (93%) Frame = -1 Query: 532 MKLADETIEAILDKTFVEADSNQDGKIDKSEWQIFVGRNPSLLKIMTLPYLRDITTTFPS 353 MKLADETIEAILDKTF++AD NQDGKID SEW+ FV RNPSLLKIMTLPYLRDITTTFPS Sbjct: 142 MKLADETIEAILDKTFLDADVNQDGKIDISEWKNFVSRNPSLLKIMTLPYLRDITTTFPS 201 Query: 352 FVFHSEVDEVAT 317 FVFHSEVDE AT Sbjct: 202 FVFHSEVDEFAT 213 >ref|XP_006361193.1| PREDICTED: calcineurin B-like protein 1-like [Solanum tuberosum] Length = 215 Score = 129 bits (323), Expect = 5e-28 Identities = 63/72 (87%), Positives = 65/72 (90%) Frame = -1 Query: 532 MKLADETIEAILDKTFVEADSNQDGKIDKSEWQIFVGRNPSLLKIMTLPYLRDITTTFPS 353 M L DET+E ILDKTF+EADSNQDGKID SEW FVGRNPSLLKIMTLPYLRDITTTFPS Sbjct: 142 MTLDDETVEIILDKTFLEADSNQDGKIDLSEWHDFVGRNPSLLKIMTLPYLRDITTTFPS 201 Query: 352 FVFHSEVDEVAT 317 FVFHSEVDE AT Sbjct: 202 FVFHSEVDEAAT 213 >gb|EOY24156.1| Calcineurin B-like protein 1 isoform 1 [Theobroma cacao] gi|508776901|gb|EOY24157.1| Calcineurin B-like protein 1 isoform 1 [Theobroma cacao] Length = 213 Score = 129 bits (323), Expect = 5e-28 Identities = 64/72 (88%), Positives = 68/72 (94%) Frame = -1 Query: 532 MKLADETIEAILDKTFVEADSNQDGKIDKSEWQIFVGRNPSLLKIMTLPYLRDITTTFPS 353 MKLADETIEAILDKTF++AD NQDGKID SEW+ FV RNPSLLKIMTLPYLRDITTTFPS Sbjct: 142 MKLADETIEAILDKTFLDADINQDGKIDISEWKNFVSRNPSLLKIMTLPYLRDITTTFPS 201 Query: 352 FVFHSEVDEVAT 317 FVF+SEVDEVAT Sbjct: 202 FVFNSEVDEVAT 213 >ref|XP_004164617.1| PREDICTED: calcineurin B-like protein 1-like [Cucumis sativus] Length = 213 Score = 128 bits (322), Expect = 7e-28 Identities = 62/72 (86%), Positives = 67/72 (93%) Frame = -1 Query: 532 MKLADETIEAILDKTFVEADSNQDGKIDKSEWQIFVGRNPSLLKIMTLPYLRDITTTFPS 353 MKLADETIE ILDKTF+EAD NQDGKIDK EWQ FV +NPSLLK+MTLPYLRDITTTFPS Sbjct: 142 MKLADETIEIILDKTFLEADVNQDGKIDKIEWQNFVSKNPSLLKVMTLPYLRDITTTFPS 201 Query: 352 FVFHSEVDEVAT 317 FVF+SEVDE+AT Sbjct: 202 FVFNSEVDEIAT 213 >ref|XP_004147242.1| PREDICTED: calcineurin B-like protein 1-like [Cucumis sativus] Length = 213 Score = 128 bits (322), Expect = 7e-28 Identities = 62/72 (86%), Positives = 67/72 (93%) Frame = -1 Query: 532 MKLADETIEAILDKTFVEADSNQDGKIDKSEWQIFVGRNPSLLKIMTLPYLRDITTTFPS 353 MKLADETIE ILDKTF+EAD NQDGKIDK EWQ FV +NPSLLK+MTLPYLRDITTTFPS Sbjct: 142 MKLADETIEIILDKTFLEADVNQDGKIDKIEWQNFVSKNPSLLKVMTLPYLRDITTTFPS 201 Query: 352 FVFHSEVDEVAT 317 FVF+SEVDE+AT Sbjct: 202 FVFNSEVDEIAT 213 >ref|XP_006284521.1| hypothetical protein CARUB_v10005722mg [Capsella rubella] gi|482553226|gb|EOA17419.1| hypothetical protein CARUB_v10005722mg [Capsella rubella] Length = 213 Score = 127 bits (319), Expect = 2e-27 Identities = 62/72 (86%), Positives = 65/72 (90%) Frame = -1 Query: 532 MKLADETIEAILDKTFVEADSNQDGKIDKSEWQIFVGRNPSLLKIMTLPYLRDITTTFPS 353 MKLADETIE ILDKTF +AD NQDGKIDK EW FV +NPSLLKIMTLPYLRDITTTFPS Sbjct: 142 MKLADETIEIILDKTFEDADVNQDGKIDKLEWSDFVNKNPSLLKIMTLPYLRDITTTFPS 201 Query: 352 FVFHSEVDEVAT 317 FVFHSEVDE+AT Sbjct: 202 FVFHSEVDEIAT 213 >ref|NP_974566.1| calcineurin B-like protein 1 [Arabidopsis thaliana] gi|332658522|gb|AEE83922.1| calcineurin B-like protein 1 [Arabidopsis thaliana] Length = 171 Score = 127 bits (319), Expect = 2e-27 Identities = 62/72 (86%), Positives = 65/72 (90%) Frame = -1 Query: 532 MKLADETIEAILDKTFVEADSNQDGKIDKSEWQIFVGRNPSLLKIMTLPYLRDITTTFPS 353 MKLADETIE ILDKTF +AD NQDGKIDK EW FV +NPSLLKIMTLPYLRDITTTFPS Sbjct: 100 MKLADETIEIILDKTFEDADVNQDGKIDKLEWSDFVNKNPSLLKIMTLPYLRDITTTFPS 159 Query: 352 FVFHSEVDEVAT 317 FVFHSEVDE+AT Sbjct: 160 FVFHSEVDEIAT 171 >ref|NP_567533.1| calcineurin B-like protein 1 [Arabidopsis thaliana] gi|56748635|sp|O81445.3|CNBL1_ARATH RecName: Full=Calcineurin B-like protein 1; AltName: Full=SOS3-like calcium-binding protein 5 gi|3309082|gb|AAC26008.1| calcineurin B-like protein 1 [Arabidopsis thaliana] gi|26452611|dbj|BAC43389.1| putative calcineurin B-like protein 1 [Arabidopsis thaliana] gi|28973325|gb|AAO63987.1| putative calcineurin B-like protein 1 [Arabidopsis thaliana] gi|332658521|gb|AEE83921.1| calcineurin B-like protein 1 [Arabidopsis thaliana] Length = 213 Score = 127 bits (319), Expect = 2e-27 Identities = 62/72 (86%), Positives = 65/72 (90%) Frame = -1 Query: 532 MKLADETIEAILDKTFVEADSNQDGKIDKSEWQIFVGRNPSLLKIMTLPYLRDITTTFPS 353 MKLADETIE ILDKTF +AD NQDGKIDK EW FV +NPSLLKIMTLPYLRDITTTFPS Sbjct: 142 MKLADETIEIILDKTFEDADVNQDGKIDKLEWSDFVNKNPSLLKIMTLPYLRDITTTFPS 201 Query: 352 FVFHSEVDEVAT 317 FVFHSEVDE+AT Sbjct: 202 FVFHSEVDEIAT 213 >gb|AHA98342.1| calcineurin B-like protein [Pyrus betulifolia] gi|559147225|gb|AHA98343.1| calcineurin B-like protein [Pyrus betulifolia] Length = 213 Score = 127 bits (318), Expect = 2e-27 Identities = 62/72 (86%), Positives = 66/72 (91%) Frame = -1 Query: 532 MKLADETIEAILDKTFVEADSNQDGKIDKSEWQIFVGRNPSLLKIMTLPYLRDITTTFPS 353 MKLADETIE ILDKTF+EAD NQDGKIDK EW FV +NPSLLKIMTLPYLRDITTTFPS Sbjct: 142 MKLADETIEIILDKTFLEADVNQDGKIDKYEWNNFVSKNPSLLKIMTLPYLRDITTTFPS 201 Query: 352 FVFHSEVDEVAT 317 FVF+SEVDE+AT Sbjct: 202 FVFNSEVDEIAT 213 >ref|XP_002329597.1| predicted protein [Populus trichocarpa] gi|133925815|gb|ABO43660.1| calcineurin B-like protein 1 [Populus trichocarpa] Length = 213 Score = 127 bits (318), Expect = 2e-27 Identities = 61/72 (84%), Positives = 68/72 (94%) Frame = -1 Query: 532 MKLADETIEAILDKTFVEADSNQDGKIDKSEWQIFVGRNPSLLKIMTLPYLRDITTTFPS 353 MKLADET+E ILDKTF++AD N+DGKIDKSEW+ FV RNPSLLKIMTLPYLRDITTTFPS Sbjct: 142 MKLADETVEIILDKTFLDADVNRDGKIDKSEWENFVCRNPSLLKIMTLPYLRDITTTFPS 201 Query: 352 FVFHSEVDEVAT 317 FVF+SEVDE+AT Sbjct: 202 FVFNSEVDEIAT 213 >ref|XP_004148365.1| PREDICTED: calcineurin B-like protein 1-like [Cucumis sativus] gi|449505233|ref|XP_004162412.1| PREDICTED: calcineurin B-like protein 1-like [Cucumis sativus] Length = 213 Score = 126 bits (317), Expect = 3e-27 Identities = 60/71 (84%), Positives = 66/71 (92%) Frame = -1 Query: 532 MKLADETIEAILDKTFVEADSNQDGKIDKSEWQIFVGRNPSLLKIMTLPYLRDITTTFPS 353 MKLADET+EAILDKTF+EAD+NQDGKID SEWQ FV +NPSLL+IMTLPYLRDITT FPS Sbjct: 142 MKLADETVEAILDKTFLEADTNQDGKIDMSEWQYFVSKNPSLLRIMTLPYLRDITTAFPS 201 Query: 352 FVFHSEVDEVA 320 FVF+SEVDE A Sbjct: 202 FVFYSEVDEAA 212 >ref|XP_006477069.1| PREDICTED: calcineurin B-like protein 1-like [Citrus sinensis] Length = 213 Score = 126 bits (316), Expect = 3e-27 Identities = 60/72 (83%), Positives = 67/72 (93%) Frame = -1 Query: 532 MKLADETIEAILDKTFVEADSNQDGKIDKSEWQIFVGRNPSLLKIMTLPYLRDITTTFPS 353 MKLADETIE ILDKTF++AD NQDGKIDK EWQ FV +NPSLLKIMTLPYLRDITT+FPS Sbjct: 142 MKLADETIEIILDKTFLDADVNQDGKIDKCEWQNFVSKNPSLLKIMTLPYLRDITTSFPS 201 Query: 352 FVFHSEVDEVAT 317 F+F+SEVDE+AT Sbjct: 202 FIFNSEVDEIAT 213 >ref|XP_006440156.1| hypothetical protein CICLE_v10022219mg [Citrus clementina] gi|557542418|gb|ESR53396.1| hypothetical protein CICLE_v10022219mg [Citrus clementina] Length = 213 Score = 126 bits (316), Expect = 3e-27 Identities = 60/72 (83%), Positives = 67/72 (93%) Frame = -1 Query: 532 MKLADETIEAILDKTFVEADSNQDGKIDKSEWQIFVGRNPSLLKIMTLPYLRDITTTFPS 353 MKLADETIE ILDKTF++AD NQDGKIDK EWQ FV +NPSLLKIMTLPYLRDITT+FPS Sbjct: 142 MKLADETIEIILDKTFLDADVNQDGKIDKCEWQNFVSKNPSLLKIMTLPYLRDITTSFPS 201 Query: 352 FVFHSEVDEVAT 317 F+F+SEVDE+AT Sbjct: 202 FIFNSEVDEIAT 213 >ref|XP_004242278.1| PREDICTED: calcineurin B-like protein 1-like [Solanum lycopersicum] Length = 215 Score = 126 bits (316), Expect = 3e-27 Identities = 61/70 (87%), Positives = 64/70 (91%) Frame = -1 Query: 526 LADETIEAILDKTFVEADSNQDGKIDKSEWQIFVGRNPSLLKIMTLPYLRDITTTFPSFV 347 L +E +E ILDKTF+EADSNQDGKIDKSEW FVGRNPSLLKIMTLPYLRDITTTFPSFV Sbjct: 144 LDEEIVEIILDKTFLEADSNQDGKIDKSEWHEFVGRNPSLLKIMTLPYLRDITTTFPSFV 203 Query: 346 FHSEVDEVAT 317 FHSEVDE AT Sbjct: 204 FHSEVDEAAT 213 >gb|EPS61218.1| hypothetical protein M569_13582 [Genlisea aurea] Length = 213 Score = 125 bits (315), Expect = 5e-27 Identities = 61/72 (84%), Positives = 67/72 (93%) Frame = -1 Query: 532 MKLADETIEAILDKTFVEADSNQDGKIDKSEWQIFVGRNPSLLKIMTLPYLRDITTTFPS 353 MKLADETIEAILDKTF+EAD++ DGKIDK+EW FV RNPSL+KIMTL YLRDITTTFPS Sbjct: 142 MKLADETIEAILDKTFIEADADGDGKIDKTEWLNFVTRNPSLMKIMTLTYLRDITTTFPS 201 Query: 352 FVFHSEVDEVAT 317 FVFHSEVDE+AT Sbjct: 202 FVFHSEVDEIAT 213