BLASTX nr result
ID: Atropa21_contig00029194
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00029194 (473 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006341161.1| PREDICTED: PAN domain-containing protein At5... 69 5e-10 ref|XP_004246898.1| PREDICTED: PAN domain-containing protein At5... 69 5e-10 >ref|XP_006341161.1| PREDICTED: PAN domain-containing protein At5g03700-like [Solanum tuberosum] Length = 501 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -3 Query: 471 RKRKRGVSGYVEEDGMVVGPYKDLGNASFRSIELSER 361 RKR+RGVSGYV++DG+VVGPYKDLGNASFRSIEL ER Sbjct: 465 RKRERGVSGYVDDDGVVVGPYKDLGNASFRSIELIER 501 >ref|XP_004246898.1| PREDICTED: PAN domain-containing protein At5g03700-like [Solanum lycopersicum] Length = 496 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -3 Query: 471 RKRKRGVSGYVEEDGMVVGPYKDLGNASFRSIELSER 361 RKR+RGVSGYV++DG+VVGPYKDLGNASFRSIEL ER Sbjct: 460 RKRERGVSGYVDDDGVVVGPYKDLGNASFRSIELIER 496