BLASTX nr result
ID: Atropa21_contig00028730
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00028730 (643 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006366368.1| PREDICTED: protease Do-like 2, chloroplastic... 86 7e-15 ref|XP_004247469.1| PREDICTED: protease Do-like 2, chloroplastic... 86 1e-14 ref|XP_006295823.1| hypothetical protein CARUB_v10024950mg [Caps... 69 1e-09 ref|NP_566115.1| DegP2 protease [Arabidopsis thaliana] gi|752202... 69 1e-09 pdb|4FLN|A Chain A, Crystal Structure Of Plant Protease Deg2 gi|... 69 1e-09 ref|XP_002882138.1| hypothetical protein ARALYDRAFT_483986 [Arab... 69 1e-09 ref|XP_002863059.1| hypothetical protein ARALYDRAFT_497185 [Arab... 69 1e-09 ref|NP_001118544.1| DegP2 protease [Arabidopsis thaliana] gi|330... 69 1e-09 ref|XP_004290719.1| PREDICTED: protease Do-like 2, chloroplastic... 68 2e-09 ref|XP_006397989.1| hypothetical protein EUTSA_v10001363mg [Eutr... 67 3e-09 gb|AFK37778.1| unknown [Lotus japonicus] 67 3e-09 ref|XP_004495997.1| PREDICTED: protease Do-like 2, chloroplastic... 67 6e-09 gb|EMJ01505.1| hypothetical protein PRUPE_ppa002853mg [Prunus pe... 67 6e-09 ref|XP_004148888.1| PREDICTED: protease Do-like 2, chloroplastic... 67 6e-09 ref|XP_006588605.1| PREDICTED: protease Do-like 2, chloroplastic... 66 7e-09 ref|XP_006444216.1| hypothetical protein CICLE_v10019366mg [Citr... 66 7e-09 ref|XP_003536894.1| PREDICTED: protease Do-like 2, chloroplastic... 66 7e-09 ref|XP_006479864.1| PREDICTED: protease Do-like 2, chloroplastic... 65 2e-08 gb|EOX94934.1| DEGP protease 2 isoform 2 [Theobroma cacao] 65 2e-08 gb|EOX94933.1| DEGP protease 2 isoform 1 [Theobroma cacao] 65 2e-08 >ref|XP_006366368.1| PREDICTED: protease Do-like 2, chloroplastic-like [Solanum tuberosum] Length = 621 Score = 86.3 bits (212), Expect = 7e-15 Identities = 43/54 (79%), Positives = 46/54 (85%) Frame = -3 Query: 641 ASILKDYGIPAERSSDLLGPYVDPIEQSEATNQHKFGDSPVSNSEFGYKGLLSA 480 +SIL DYGIPAERSSDLL PYVD I EAT+QH+FGDSPVSNSEFGY GLL A Sbjct: 568 SSILIDYGIPAERSSDLLEPYVDSIGPDEATDQHEFGDSPVSNSEFGYDGLLWA 621 >ref|XP_004247469.1| PREDICTED: protease Do-like 2, chloroplastic-like [Solanum lycopersicum] Length = 621 Score = 85.5 bits (210), Expect = 1e-14 Identities = 43/54 (79%), Positives = 46/54 (85%) Frame = -3 Query: 641 ASILKDYGIPAERSSDLLGPYVDPIEQSEATNQHKFGDSPVSNSEFGYKGLLSA 480 +SIL DYGIPAERSSDLL PYVD I EAT+QH+FGDSPVSNSEFGY GLL A Sbjct: 568 SSILIDYGIPAERSSDLLEPYVDSIGPYEATDQHEFGDSPVSNSEFGYDGLLWA 621 >ref|XP_006295823.1| hypothetical protein CARUB_v10024950mg [Capsella rubella] gi|482564531|gb|EOA28721.1| hypothetical protein CARUB_v10024950mg [Capsella rubella] Length = 604 Score = 68.6 bits (166), Expect = 1e-09 Identities = 34/52 (65%), Positives = 42/52 (80%) Frame = -3 Query: 635 ILKDYGIPAERSSDLLGPYVDPIEQSEATNQHKFGDSPVSNSEFGYKGLLSA 480 ILKDYGIP+ERS+DLL PYVDPI+ ++A +Q GDSPVSN E G+ GL+ A Sbjct: 554 ILKDYGIPSERSADLLEPYVDPIDDNQALDQ-GIGDSPVSNLEIGFDGLVWA 604 >ref|NP_566115.1| DegP2 protease [Arabidopsis thaliana] gi|75220233|sp|O82261.2|DEGP2_ARATH RecName: Full=Protease Do-like 2, chloroplastic; Flags: Precursor gi|11908036|gb|AAG41447.1|AF326865_1 putative DegP2 protease [Arabidopsis thaliana] gi|13172275|gb|AAK14061.1|AF245171_1 DegP2 protease [Arabidopsis thaliana] gi|13194802|gb|AAK15563.1|AF349516_1 putative DegP2 protease [Arabidopsis thaliana] gi|18700190|gb|AAL77706.1| At2g47940/F17A22.33 [Arabidopsis thaliana] gi|20197307|gb|AAC63648.2| DegP2 protease [Arabidopsis thaliana] gi|20197550|gb|AAM15122.1| DegP2 protease [Arabidopsis thaliana] gi|20857214|gb|AAM26706.1| At2g47940/F17A22.33 [Arabidopsis thaliana] gi|330255820|gb|AEC10914.1| DegP2 protease [Arabidopsis thaliana] Length = 607 Score = 68.6 bits (166), Expect = 1e-09 Identities = 34/52 (65%), Positives = 42/52 (80%) Frame = -3 Query: 635 ILKDYGIPAERSSDLLGPYVDPIEQSEATNQHKFGDSPVSNSEFGYKGLLSA 480 ILKDYGIP+ERS+DLL PYVDPI+ ++A +Q GDSPVSN E G+ GL+ A Sbjct: 557 ILKDYGIPSERSADLLEPYVDPIDDTQALDQ-GIGDSPVSNLEIGFDGLVWA 607 >pdb|4FLN|A Chain A, Crystal Structure Of Plant Protease Deg2 gi|405944959|pdb|4FLN|B Chain B, Crystal Structure Of Plant Protease Deg2 gi|405944960|pdb|4FLN|C Chain C, Crystal Structure Of Plant Protease Deg2 Length = 539 Score = 68.6 bits (166), Expect = 1e-09 Identities = 34/52 (65%), Positives = 42/52 (80%) Frame = -3 Query: 635 ILKDYGIPAERSSDLLGPYVDPIEQSEATNQHKFGDSPVSNSEFGYKGLLSA 480 ILKDYGIP+ERS+DLL PYVDPI+ ++A +Q GDSPVSN E G+ GL+ A Sbjct: 489 ILKDYGIPSERSADLLEPYVDPIDDTQALDQ-GIGDSPVSNLEIGFDGLVWA 539 >ref|XP_002882138.1| hypothetical protein ARALYDRAFT_483986 [Arabidopsis lyrata subsp. lyrata] gi|297327977|gb|EFH58397.1| hypothetical protein ARALYDRAFT_483986 [Arabidopsis lyrata subsp. lyrata] Length = 613 Score = 68.6 bits (166), Expect = 1e-09 Identities = 34/52 (65%), Positives = 42/52 (80%) Frame = -3 Query: 635 ILKDYGIPAERSSDLLGPYVDPIEQSEATNQHKFGDSPVSNSEFGYKGLLSA 480 ILKDYGIP+ERS+DLL PYVDPI+ ++A +Q GDSPVSN E G+ GL+ A Sbjct: 563 ILKDYGIPSERSADLLEPYVDPIDDTQALDQ-GIGDSPVSNLEIGFDGLVWA 613 >ref|XP_002863059.1| hypothetical protein ARALYDRAFT_497185 [Arabidopsis lyrata subsp. lyrata] gi|297308865|gb|EFH39318.1| hypothetical protein ARALYDRAFT_497185 [Arabidopsis lyrata subsp. lyrata] Length = 610 Score = 68.6 bits (166), Expect = 1e-09 Identities = 34/52 (65%), Positives = 42/52 (80%) Frame = -3 Query: 635 ILKDYGIPAERSSDLLGPYVDPIEQSEATNQHKFGDSPVSNSEFGYKGLLSA 480 ILKDYGIP+ERS+DLL PYVDPI+ ++A +Q GDSPVSN E G+ GL+ A Sbjct: 560 ILKDYGIPSERSADLLEPYVDPIDDTQALDQ-GIGDSPVSNLEIGFDGLVWA 610 >ref|NP_001118544.1| DegP2 protease [Arabidopsis thaliana] gi|330255821|gb|AEC10915.1| DegP2 protease [Arabidopsis thaliana] Length = 606 Score = 68.6 bits (166), Expect = 1e-09 Identities = 34/52 (65%), Positives = 42/52 (80%) Frame = -3 Query: 635 ILKDYGIPAERSSDLLGPYVDPIEQSEATNQHKFGDSPVSNSEFGYKGLLSA 480 ILKDYGIP+ERS+DLL PYVDPI+ ++A +Q GDSPVSN E G+ GL+ A Sbjct: 556 ILKDYGIPSERSADLLEPYVDPIDDTQALDQ-GIGDSPVSNLEIGFDGLVWA 606 >ref|XP_004290719.1| PREDICTED: protease Do-like 2, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 622 Score = 68.2 bits (165), Expect = 2e-09 Identities = 35/53 (66%), Positives = 40/53 (75%) Frame = -3 Query: 638 SILKDYGIPAERSSDLLGPYVDPIEQSEATNQHKFGDSPVSNSEFGYKGLLSA 480 SILKDYGIPAERSSDLL PYVD + +A +Q GDSPVSN E G+ GL+ A Sbjct: 571 SILKDYGIPAERSSDLLEPYVDSVVDGQA-DQEDLGDSPVSNLEIGFDGLIWA 622 >ref|XP_006397989.1| hypothetical protein EUTSA_v10001363mg [Eutrema salsugineum] gi|557099062|gb|ESQ39442.1| hypothetical protein EUTSA_v10001363mg [Eutrema salsugineum] Length = 612 Score = 67.4 bits (163), Expect = 3e-09 Identities = 33/52 (63%), Positives = 41/52 (78%) Frame = -3 Query: 635 ILKDYGIPAERSSDLLGPYVDPIEQSEATNQHKFGDSPVSNSEFGYKGLLSA 480 ILKDYGIP+ERS+DL PY+DPI+ + A +Q FGDSPVSN E G+ GL+ A Sbjct: 562 ILKDYGIPSERSADLREPYIDPIDDTRALDQ-GFGDSPVSNLEIGFDGLVWA 612 >gb|AFK37778.1| unknown [Lotus japonicus] Length = 144 Score = 67.4 bits (163), Expect = 3e-09 Identities = 34/54 (62%), Positives = 43/54 (79%) Frame = -3 Query: 641 ASILKDYGIPAERSSDLLGPYVDPIEQSEATNQHKFGDSPVSNSEFGYKGLLSA 480 +SIL DYGIP+ERSSDLL PYVD +E + ++Q +FGD+PVSN E G +GLL A Sbjct: 92 SSILTDYGIPSERSSDLLKPYVDSLESGQPSDQ-EFGDTPVSNYEIGSEGLLWA 144 >ref|XP_004495997.1| PREDICTED: protease Do-like 2, chloroplastic-like [Cicer arietinum] Length = 600 Score = 66.6 bits (161), Expect = 6e-09 Identities = 33/54 (61%), Positives = 42/54 (77%) Frame = -3 Query: 641 ASILKDYGIPAERSSDLLGPYVDPIEQSEATNQHKFGDSPVSNSEFGYKGLLSA 480 +S+L+DYGIP+ERSSDLL PYVD +E + +Q +FGD PVSN E G+ GLL A Sbjct: 548 SSLLRDYGIPSERSSDLLQPYVDSLEGDQPADQ-EFGDCPVSNFEVGHDGLLLA 600 >gb|EMJ01505.1| hypothetical protein PRUPE_ppa002853mg [Prunus persica] Length = 628 Score = 66.6 bits (161), Expect = 6e-09 Identities = 33/52 (63%), Positives = 40/52 (76%) Frame = -3 Query: 635 ILKDYGIPAERSSDLLGPYVDPIEQSEATNQHKFGDSPVSNSEFGYKGLLSA 480 ILKDYGIP+ERSSDLL PYVD + ++A NQ GDSPVSN E G+ G++ A Sbjct: 578 ILKDYGIPSERSSDLLEPYVDSLGDNQAVNQ-DIGDSPVSNLEIGFDGIIWA 628 >ref|XP_004148888.1| PREDICTED: protease Do-like 2, chloroplastic-like [Cucumis sativus] gi|449491511|ref|XP_004158921.1| PREDICTED: protease Do-like 2, chloroplastic-like [Cucumis sativus] Length = 623 Score = 66.6 bits (161), Expect = 6e-09 Identities = 32/52 (61%), Positives = 39/52 (75%) Frame = -3 Query: 635 ILKDYGIPAERSSDLLGPYVDPIEQSEATNQHKFGDSPVSNSEFGYKGLLSA 480 IL+DYGIP+ERSSDLL PYVD E + +GDSPVSN+E G++GLL A Sbjct: 572 ILRDYGIPSERSSDLLEPYVDISEDEKGMVVQNYGDSPVSNAEIGFEGLLWA 623 >ref|XP_006588605.1| PREDICTED: protease Do-like 2, chloroplastic-like isoform X2 [Glycine max] Length = 513 Score = 66.2 bits (160), Expect = 7e-09 Identities = 34/54 (62%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = -3 Query: 638 SILKDYGIPAERSSDLLGPYVDPIE-QSEATNQHKFGDSPVSNSEFGYKGLLSA 480 S+L DYGIP+ERSSDLL PYVD +E + + +FGDSPVSN EFG GLL A Sbjct: 460 SVLSDYGIPSERSSDLLKPYVDALEVEGDQPADEEFGDSPVSNYEFGPDGLLWA 513 >ref|XP_006444216.1| hypothetical protein CICLE_v10019366mg [Citrus clementina] gi|557546478|gb|ESR57456.1| hypothetical protein CICLE_v10019366mg [Citrus clementina] Length = 606 Score = 66.2 bits (160), Expect = 7e-09 Identities = 33/49 (67%), Positives = 39/49 (79%) Frame = -3 Query: 635 ILKDYGIPAERSSDLLGPYVDPIEQSEATNQHKFGDSPVSNSEFGYKGL 489 ILKDYGIP+ERSSDLL PYVDP+ ++A NQ GDSPVS+ E G+ GL Sbjct: 556 ILKDYGIPSERSSDLLEPYVDPLGGNQAINQDS-GDSPVSDLEIGFDGL 603 >ref|XP_003536894.1| PREDICTED: protease Do-like 2, chloroplastic-like isoform X1 [Glycine max] Length = 612 Score = 66.2 bits (160), Expect = 7e-09 Identities = 34/54 (62%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = -3 Query: 638 SILKDYGIPAERSSDLLGPYVDPIE-QSEATNQHKFGDSPVSNSEFGYKGLLSA 480 S+L DYGIP+ERSSDLL PYVD +E + + +FGDSPVSN EFG GLL A Sbjct: 559 SVLSDYGIPSERSSDLLKPYVDALEVEGDQPADEEFGDSPVSNYEFGPDGLLWA 612 >ref|XP_006479864.1| PREDICTED: protease Do-like 2, chloroplastic-like [Citrus sinensis] Length = 606 Score = 64.7 bits (156), Expect = 2e-08 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = -3 Query: 635 ILKDYGIPAERSSDLLGPYVDPIEQSEATNQHKFGDSPVSNSEFGYKGL 489 ILKDYGIP+ERSSDLL P+VDP+ ++A NQ GDSPVS+ E G+ GL Sbjct: 556 ILKDYGIPSERSSDLLEPFVDPLGGNQAINQDS-GDSPVSDLEIGFDGL 603 >gb|EOX94934.1| DEGP protease 2 isoform 2 [Theobroma cacao] Length = 634 Score = 64.7 bits (156), Expect = 2e-08 Identities = 32/52 (61%), Positives = 40/52 (76%) Frame = -3 Query: 635 ILKDYGIPAERSSDLLGPYVDPIEQSEATNQHKFGDSPVSNSEFGYKGLLSA 480 ILKDYGIP+E+S DLL PYVD + ++A Q +GDSPVSN E G++GLL A Sbjct: 584 ILKDYGIPSEKSDDLLEPYVDSLGDNQAIEQ-DYGDSPVSNLEIGFEGLLWA 634 >gb|EOX94933.1| DEGP protease 2 isoform 1 [Theobroma cacao] Length = 633 Score = 64.7 bits (156), Expect = 2e-08 Identities = 32/52 (61%), Positives = 40/52 (76%) Frame = -3 Query: 635 ILKDYGIPAERSSDLLGPYVDPIEQSEATNQHKFGDSPVSNSEFGYKGLLSA 480 ILKDYGIP+E+S DLL PYVD + ++A Q +GDSPVSN E G++GLL A Sbjct: 583 ILKDYGIPSEKSDDLLEPYVDSLGDNQAIEQ-DYGDSPVSNLEIGFEGLLWA 633