BLASTX nr result
ID: Atropa21_contig00028553
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00028553 (639 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAD99221.1| polypepetide with reverse transcriptase and RNas... 40 3e-06 >dbj|BAD99221.1| polypepetide with reverse transcriptase and RNaseH domains [Petunia x hybrida] Length = 389 Score = 39.7 bits (91), Expect(2) = 3e-06 Identities = 17/34 (50%), Positives = 25/34 (73%) Frame = -1 Query: 174 LAFVF*SLSQYMQQP*SVHLQAALHTLKYLHKDP 73 ++F +LSQ+MQ P S HL+AA HTL+Y+ +P Sbjct: 181 ISFAVQTLSQHMQSPRSGHLEAAYHTLRYIRNNP 214 Score = 37.7 bits (86), Expect(2) = 3e-06 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = -3 Query: 76 PKLGALINSSPSLQILGFCDADWAS 2 P LG ++S S Q+ GFCDADWAS Sbjct: 214 PGLGIFLSSEQSFQLTGFCDADWAS 238