BLASTX nr result
ID: Atropa21_contig00027778
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00027778 (669 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_817526.1| hypothetical chloroplast RF2 [Coffea arabica] g... 60 8e-07 prf||1211235CA ORF 1708 59 1e-06 ref|NP_064100.1| orf204 gene product (mitochondrion) [Beta vulga... 59 1e-06 gb|AHH30482.1| hypothetical chloroplast RF2 (chloroplast) [Barts... 59 1e-06 ref|YP_008999976.1| hypothetical chloroplast RF21 (chloroplast) ... 59 1e-06 ref|YP_008963735.1| hypothetical chloroplast RF21 (chloroplast) ... 59 1e-06 gb|AFK81537.1| hypothetical chloroplast RF21 [Camellia taliensis] 59 1e-06 gb|AFK81516.1| hypothetical chloroplast RF21 [Camellia taliensis] 59 1e-06 ref|YP_008964078.1| hypothetical chloroplast RF2 [Ajuga reptans]... 59 1e-06 ref|YP_008815248.1| hypothetical chloroplast RF21 (chloroplast) ... 59 1e-06 ref|YP_008815161.1| hypothetical chloroplast RF21 (chloroplast) ... 59 1e-06 ref|YP_008815074.1| hypothetical chloroplast RF21 (chloroplast) ... 59 1e-06 ref|YP_008814987.1| hypothetical chloroplast RF21 (chloroplast) ... 59 1e-06 ref|YP_008814900.1| hypothetical chloroplast RF21 (chloroplast) ... 59 1e-06 gb|AGW04940.1| hypothetical chloroplast protein [Telosma cordata] 59 1e-06 gb|AGW04863.1| hypothetical chloroplast protein [Sisyranthus tri... 59 1e-06 gb|AGW04329.1| hypothetical chloroplast protein [Secamone afzelii] 59 1e-06 ref|YP_008578216.1| Ycf2 (chloroplast) [Stockwellia quadrifida] ... 59 1e-06 ref|YP_008578131.1| Ycf2 (chloroplast) [Allosyncarpia ternata] g... 59 1e-06 ref|YP_008577961.1| Ycf2 (chloroplast) [Angophora floribunda] gi... 59 1e-06 >ref|YP_817526.1| hypothetical chloroplast RF2 [Coffea arabica] gi|116617170|ref|YP_817543.1| hypothetical chloroplast RF2 [Coffea arabica] gi|122153663|sp|A0A379.1|YCF2_COFAR RecName: Full=Protein Ycf2 gi|116242207|gb|ABJ89722.1| hypothetical chloroplast RF2 [Coffea arabica] gi|116242226|gb|ABJ89741.1| hypothetical chloroplast RF2 [Coffea arabica] Length = 2281 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 519 LLCLMKCIEKGQMCRIFQRNGDFSTLSKWNLFQT 620 +LCL KC+EKGQM R FQR+ FSTLSKWNLFQT Sbjct: 1202 ILCLKKCVEKGQMYRTFQRDSAFSTLSKWNLFQT 1235 >prf||1211235CA ORF 1708 Length = 1000 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 522 LCLMKCIEKGQMCRIFQRNGDFSTLSKWNLFQT 620 LCL KC+EKGQM R FQR+ FSTLSKWNLFQT Sbjct: 629 LCLKKCVEKGQMYRTFQRDSAFSTLSKWNLFQT 661 >ref|NP_064100.1| orf204 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435124|ref|YP_004222342.1| hypothetical protein BevumaM_p108 [Beta vulgaris subsp. maritima] gi|9087350|dbj|BAA99494.1| orf204 [Beta vulgaris subsp. vulgaris] gi|317905678|emb|CBJ14072.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439857|emb|CBJ17562.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|384939120|emb|CBL51966.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 204 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 522 LCLMKCIEKGQMCRIFQRNGDFSTLSKWNLFQT 620 LCL KC+EKGQM R FQR+ FSTLSKWNLFQT Sbjct: 137 LCLKKCVEKGQMYRTFQRDSAFSTLSKWNLFQT 169 >gb|AHH30482.1| hypothetical chloroplast RF2 (chloroplast) [Bartsia inaequalis] gi|576598331|gb|AHH30493.1| hypothetical chloroplast RF2 (chloroplast) [Bartsia inaequalis] Length = 2269 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 522 LCLMKCIEKGQMCRIFQRNGDFSTLSKWNLFQT 620 LCL KC+EKGQM R FQR+ FSTLSKWNLFQT Sbjct: 1193 LCLKKCVEKGQMYRTFQRDSAFSTLSKWNLFQT 1225 >ref|YP_008999976.1| hypothetical chloroplast RF21 (chloroplast) [Agrostemma githago] gi|576303675|ref|YP_008999993.1| hypothetical chloroplast RF21 (chloroplast) [Agrostemma githago] gi|555944063|gb|AGZ17967.1| hypothetical chloroplast RF21 (chloroplast) [Agrostemma githago] gi|555944080|gb|AGZ17984.1| hypothetical chloroplast RF21 (chloroplast) [Agrostemma githago] Length = 2043 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 522 LCLMKCIEKGQMCRIFQRNGDFSTLSKWNLFQT 620 LCL KC+EKGQM R FQR+ FSTLSKWNLFQT Sbjct: 959 LCLKKCVEKGQMYRTFQRDSAFSTLSKWNLFQT 991 >ref|YP_008963735.1| hypothetical chloroplast RF21 (chloroplast) [Liquidambar formosana] gi|568244972|ref|YP_008963754.1| hypothetical chloroplast RF21 (chloroplast) [Liquidambar formosana] gi|491650414|gb|AGL13474.1| hypothetical chloroplast RF21 (chloroplast) [Liquidambar formosana] gi|491650433|gb|AGL13493.1| hypothetical chloroplast RF21 (chloroplast) [Liquidambar formosana] Length = 2297 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 522 LCLMKCIEKGQMCRIFQRNGDFSTLSKWNLFQT 620 LCL KC+EKGQM R FQR+ FSTLSKWNLFQT Sbjct: 1204 LCLKKCVEKGQMYRTFQRDSAFSTLSKWNLFQT 1236 >gb|AFK81537.1| hypothetical chloroplast RF21 [Camellia taliensis] Length = 2298 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 522 LCLMKCIEKGQMCRIFQRNGDFSTLSKWNLFQT 620 LCL KC+EKGQM R FQR+ FSTLSKWNLFQT Sbjct: 1204 LCLKKCVEKGQMYRTFQRDSAFSTLSKWNLFQT 1236 >gb|AFK81516.1| hypothetical chloroplast RF21 [Camellia taliensis] Length = 2298 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 522 LCLMKCIEKGQMCRIFQRNGDFSTLSKWNLFQT 620 LCL KC+EKGQM R FQR+ FSTLSKWNLFQT Sbjct: 1204 LCLKKCVEKGQMYRTFQRDSAFSTLSKWNLFQT 1236 >ref|YP_008964078.1| hypothetical chloroplast RF2 [Ajuga reptans] gi|568247135|ref|YP_008964094.1| hypothetical chloroplast RF2 [Ajuga reptans] gi|558697199|gb|AHA84954.1| hypothetical chloroplast RF2 [Ajuga reptans] gi|558697206|gb|AHA84961.1| hypothetical chloroplast RF2 [Ajuga reptans] Length = 2248 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 522 LCLMKCIEKGQMCRIFQRNGDFSTLSKWNLFQT 620 LCL KC+EKGQM R FQR+ FSTLSKWNLFQT Sbjct: 1174 LCLKKCVEKGQMYRTFQRDSAFSTLSKWNLFQT 1206 >ref|YP_008815248.1| hypothetical chloroplast RF21 (chloroplast) [Kalopanax septemlobus] gi|563940449|ref|YP_008815267.1| hypothetical chloroplast RF21 (chloroplast) [Kalopanax septemlobus] gi|458599655|gb|AGG39347.1| hypothetical chloroplast RF21 (chloroplast) [Kalopanax septemlobus] gi|458599676|gb|AGG39368.1| hypothetical chloroplast RF21 (chloroplast) [Kalopanax septemlobus] Length = 2116 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 522 LCLMKCIEKGQMCRIFQRNGDFSTLSKWNLFQT 620 LCL KC+EKGQM R FQR+ FSTLSKWNLFQT Sbjct: 1002 LCLKKCVEKGQMYRTFQRDSAFSTLSKWNLFQT 1034 >ref|YP_008815161.1| hypothetical chloroplast RF21 (chloroplast) [Schefflera delavayi] gi|558603152|ref|YP_008815180.1| hypothetical chloroplast RF21 (chloroplast) [Schefflera delavayi] gi|458599567|gb|AGG39260.1| hypothetical chloroplast RF21 (chloroplast) [Schefflera delavayi] gi|458599588|gb|AGG39281.1| hypothetical chloroplast RF21 (chloroplast) [Schefflera delavayi] Length = 2132 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 522 LCLMKCIEKGQMCRIFQRNGDFSTLSKWNLFQT 620 LCL KC+EKGQM R FQR+ FSTLSKWNLFQT Sbjct: 1002 LCLKKCVEKGQMYRTFQRDSAFSTLSKWNLFQT 1034 >ref|YP_008815074.1| hypothetical chloroplast RF21 (chloroplast) [Metapanax delavayi] gi|558603064|ref|YP_008815093.1| hypothetical chloroplast RF21 (chloroplast) [Metapanax delavayi] gi|458599414|gb|AGG39173.1| hypothetical chloroplast RF21 (chloroplast) [Metapanax delavayi] gi|458599435|gb|AGG39194.1| hypothetical chloroplast RF21 (chloroplast) [Metapanax delavayi] Length = 2116 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 522 LCLMKCIEKGQMCRIFQRNGDFSTLSKWNLFQT 620 LCL KC+EKGQM R FQR+ FSTLSKWNLFQT Sbjct: 1002 LCLKKCVEKGQMYRTFQRDSAFSTLSKWNLFQT 1034 >ref|YP_008814987.1| hypothetical chloroplast RF21 (chloroplast) [Brassaiopsis hainla] gi|558602976|ref|YP_008815006.1| hypothetical chloroplast RF21 (chloroplast) [Brassaiopsis hainla] gi|458599235|gb|AGG39086.1| hypothetical chloroplast RF21 (chloroplast) [Brassaiopsis hainla] gi|458599256|gb|AGG39107.1| hypothetical chloroplast RF21 (chloroplast) [Brassaiopsis hainla] Length = 2116 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 522 LCLMKCIEKGQMCRIFQRNGDFSTLSKWNLFQT 620 LCL KC+EKGQM R FQR+ FSTLSKWNLFQT Sbjct: 1002 LCLKKCVEKGQMYRTFQRDSAFSTLSKWNLFQT 1034 >ref|YP_008814900.1| hypothetical chloroplast RF21 (chloroplast) [Aralia undulata] gi|563940343|ref|YP_008814919.1| hypothetical chloroplast RF21 (chloroplast) [Aralia undulata] gi|458599133|gb|AGG38999.1| hypothetical chloroplast RF21 (chloroplast) [Aralia undulata] gi|458599154|gb|AGG39020.1| hypothetical chloroplast RF21 (chloroplast) [Aralia undulata] Length = 2132 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 522 LCLMKCIEKGQMCRIFQRNGDFSTLSKWNLFQT 620 LCL KC+EKGQM R FQR+ FSTLSKWNLFQT Sbjct: 1002 LCLKKCVEKGQMYRTFQRDSAFSTLSKWNLFQT 1034 >gb|AGW04940.1| hypothetical chloroplast protein [Telosma cordata] Length = 2308 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 522 LCLMKCIEKGQMCRIFQRNGDFSTLSKWNLFQT 620 LCL KC+EKGQM R FQR+ FSTLSKWNLFQT Sbjct: 1194 LCLKKCVEKGQMYRTFQRDSAFSTLSKWNLFQT 1226 >gb|AGW04863.1| hypothetical chloroplast protein [Sisyranthus trichostomus] Length = 2294 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 522 LCLMKCIEKGQMCRIFQRNGDFSTLSKWNLFQT 620 LCL KC+EKGQM R FQR+ FSTLSKWNLFQT Sbjct: 1191 LCLKKCVEKGQMYRTFQRDSAFSTLSKWNLFQT 1223 >gb|AGW04329.1| hypothetical chloroplast protein [Secamone afzelii] Length = 2279 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 522 LCLMKCIEKGQMCRIFQRNGDFSTLSKWNLFQT 620 LCL KC+EKGQM R FQR+ FSTLSKWNLFQT Sbjct: 1197 LCLKKCVEKGQMYRTFQRDSAFSTLSKWNLFQT 1229 >ref|YP_008578216.1| Ycf2 (chloroplast) [Stockwellia quadrifida] gi|545719317|ref|YP_008578235.1| Ycf2 (chloroplast) [Stockwellia quadrifida] gi|442569464|gb|AGC59625.1| Ycf2 (chloroplast) [Stockwellia quadrifida] gi|442569483|gb|AGC59644.1| Ycf2 (chloroplast) [Stockwellia quadrifida] Length = 2274 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 522 LCLMKCIEKGQMCRIFQRNGDFSTLSKWNLFQT 620 LCL KC+EKGQM R FQR+ FSTLSKWNLFQT Sbjct: 1201 LCLKKCVEKGQMYRTFQRDSAFSTLSKWNLFQT 1233 >ref|YP_008578131.1| Ycf2 (chloroplast) [Allosyncarpia ternata] gi|545719489|ref|YP_008578150.1| Ycf2 (chloroplast) [Allosyncarpia ternata] gi|442569378|gb|AGC59540.1| Ycf2 (chloroplast) [Allosyncarpia ternata] gi|442569397|gb|AGC59559.1| Ycf2 (chloroplast) [Allosyncarpia ternata] Length = 2280 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 522 LCLMKCIEKGQMCRIFQRNGDFSTLSKWNLFQT 620 LCL KC+EKGQM R FQR+ FSTLSKWNLFQT Sbjct: 1201 LCLKKCVEKGQMYRTFQRDSAFSTLSKWNLFQT 1233 >ref|YP_008577961.1| Ycf2 (chloroplast) [Angophora floribunda] gi|545719145|ref|YP_008577980.1| Ycf2 (chloroplast) [Angophora floribunda] gi|545719212|ref|YP_008578046.1| Ycf2 (chloroplast) [Angophora costata] gi|545719231|ref|YP_008578065.1| Ycf2 (chloroplast) [Angophora costata] gi|442569206|gb|AGC59370.1| Ycf2 (chloroplast) [Angophora floribunda] gi|442569225|gb|AGC59389.1| Ycf2 (chloroplast) [Angophora floribunda] gi|442569292|gb|AGC59455.1| Ycf2 (chloroplast) [Angophora costata] gi|442569311|gb|AGC59474.1| Ycf2 (chloroplast) [Angophora costata] Length = 2280 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 522 LCLMKCIEKGQMCRIFQRNGDFSTLSKWNLFQT 620 LCL KC+EKGQM R FQR+ FSTLSKWNLFQT Sbjct: 1201 LCLKKCVEKGQMYRTFQRDSAFSTLSKWNLFQT 1233