BLASTX nr result
ID: Atropa21_contig00027351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00027351 (632 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAW28576.2| Gag-pol polyprotein, putative [Solanum demissum] 67 4e-09 gb|AAW28578.1| Putative gag-pol polyprotein, identical [Solanum ... 67 4e-09 gb|AAW28577.1| Putative gag-pol polyprotein, identical [Solanum ... 67 4e-09 >gb|AAW28576.2| Gag-pol polyprotein, putative [Solanum demissum] Length = 1096 Score = 67.0 bits (162), Expect = 4e-09 Identities = 34/66 (51%), Positives = 43/66 (65%) Frame = +2 Query: 224 KDKDEVIG*PRRPMKG*QAKRLQD*LAELQWEINKVLIMDEELKTKGEELDKCYHYFMAH 403 KDKD+ + PRRP+ Q K D L LQ I + LI +EELK KGEEL KCY+Y +A Sbjct: 1029 KDKDDALETPRRPITRSQTKEFNDKLNGLQSLIQRFLIGEEELKPKGEELSKCYNYLVAQ 1088 Query: 404 VQVQEE 421 +Q Q+E Sbjct: 1089 IQAQDE 1094 >gb|AAW28578.1| Putative gag-pol polyprotein, identical [Solanum demissum] Length = 1588 Score = 67.0 bits (162), Expect = 4e-09 Identities = 34/66 (51%), Positives = 43/66 (65%) Frame = +2 Query: 224 KDKDEVIG*PRRPMKG*QAKRLQD*LAELQWEINKVLIMDEELKTKGEELDKCYHYFMAH 403 KDKD+ + PRRP+ Q K D L LQ I + LI +EELK KGEEL KCY+Y +A Sbjct: 1521 KDKDDALETPRRPITRSQTKEFNDKLNGLQSLIQRFLIGEEELKPKGEELSKCYNYLVAQ 1580 Query: 404 VQVQEE 421 +Q Q+E Sbjct: 1581 IQAQDE 1586 >gb|AAW28577.1| Putative gag-pol polyprotein, identical [Solanum demissum] Length = 1588 Score = 67.0 bits (162), Expect = 4e-09 Identities = 34/66 (51%), Positives = 43/66 (65%) Frame = +2 Query: 224 KDKDEVIG*PRRPMKG*QAKRLQD*LAELQWEINKVLIMDEELKTKGEELDKCYHYFMAH 403 KDKD+ + PRRP+ Q K D L LQ I + LI +EELK KGEEL KCY+Y +A Sbjct: 1521 KDKDDALETPRRPITRSQTKEFNDKLNGLQSLIQRFLIGEEELKPKGEELSKCYNYLVAQ 1580 Query: 404 VQVQEE 421 +Q Q+E Sbjct: 1581 IQAQDE 1586