BLASTX nr result
ID: Atropa21_contig00026987
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00026987 (605 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518932.1| conserved hypothetical protein [Ricinus comm... 64 4e-08 ref|XP_006439193.1| hypothetical protein CICLE_v10023139mg [Citr... 57 5e-06 >ref|XP_002518932.1| conserved hypothetical protein [Ricinus communis] gi|223541919|gb|EEF43465.1| conserved hypothetical protein [Ricinus communis] Length = 77 Score = 63.5 bits (153), Expect = 4e-08 Identities = 35/58 (60%), Positives = 39/58 (67%) Frame = +3 Query: 276 DPDVTFHSPSNQGLGCSSSREKLRSDKSMKLVLTSEKEKFAPRFDGLRFIETLVTAHR 449 D DV FH SNQG SSS + S +S+KEKFAPRFDGLRFIETL+TAHR Sbjct: 23 DSDVAFHPSSNQG---SSSSVMGKLGASNACAPSSDKEKFAPRFDGLRFIETLITAHR 77 >ref|XP_006439193.1| hypothetical protein CICLE_v10023139mg [Citrus clementina] gi|557541455|gb|ESR52433.1| hypothetical protein CICLE_v10023139mg [Citrus clementina] Length = 78 Score = 56.6 bits (135), Expect = 5e-06 Identities = 33/56 (58%), Positives = 35/56 (62%) Frame = +3 Query: 282 DVTFHSPSNQGLGCSSSREKLRSDKSMKLVLTSEKEKFAPRFDGLRFIETLVTAHR 449 DV F+ QG CS+ K M SEKEKFAPRFDGLRFIETLVTAHR Sbjct: 27 DVAFNQKKKQG-NCSTGSGKKGGWNKMT---PSEKEKFAPRFDGLRFIETLVTAHR 78