BLASTX nr result
ID: Atropa21_contig00026868
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00026868 (911 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71467.1| hypothetical protein VITISV_038988 [Vitis vinifera] 83 2e-13 >emb|CAN71467.1| hypothetical protein VITISV_038988 [Vitis vinifera] Length = 280 Score = 82.8 bits (203), Expect = 2e-13 Identities = 39/52 (75%), Positives = 41/52 (78%) Frame = -3 Query: 231 LHCGRCPPIRLGLLPTRKNCSLASRTIGGHIWRHIENHVFRTKRNARLPNKK 76 L CGRCPP+ GLLP RKN SLASRT GG I RH ENH FRT+RNARLP KK Sbjct: 68 LRCGRCPPVGPGLLPARKNRSLASRTSGGPIRRHTENHAFRTERNARLPKKK 119