BLASTX nr result
ID: Atropa21_contig00025234
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00025234 (603 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF79879.1|AC000348_32 T7N9.5 [Arabidopsis thaliana] 39 1e-06 >gb|AAF79879.1|AC000348_32 T7N9.5 [Arabidopsis thaliana] Length = 1436 Score = 39.3 bits (90), Expect(2) = 1e-06 Identities = 20/45 (44%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = -2 Query: 521 KGFQALHLTTYSVLVSRDVLFYESIF*FTLPLFT-TSSDIFSNIF 390 KG++ L + TYSV +SR V+FYE IF F T + D F +I+ Sbjct: 815 KGYKLLDIETYSVSISRHVIFYEDIFPFASSNITDAAKDFFPHIY 859 Score = 38.9 bits (89), Expect(2) = 1e-06 Identities = 17/32 (53%), Positives = 22/32 (68%) Frame = -3 Query: 601 ATIPKCDREKFDQRASHCVFISYPFGKRGFKL 506 +T PK R KFD RA C+F+ YP G +G+KL Sbjct: 789 STSPK-SRTKFDPRAKACIFLGYPMGYKGYKL 819