BLASTX nr result
ID: Atropa21_contig00025180
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00025180 (1017 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004233579.1| PREDICTED: uncharacterized protein LOC101260... 59 4e-06 >ref|XP_004233579.1| PREDICTED: uncharacterized protein LOC101260201 [Solanum lycopersicum] Length = 1531 Score = 58.5 bits (140), Expect = 4e-06 Identities = 38/127 (29%), Positives = 66/127 (51%), Gaps = 5/127 (3%) Frame = +2 Query: 113 KLEYINIPKHCKYCKKLDHALRECRVLEKKREN-DKKEAEKIKQHNTTREQDDHGPAETL 289 K+EY +IP +C YCK H +C + ++ EN +KE EK +Q T ++ +D + L Sbjct: 15 KIEYDSIPHYCFYCKHQGHQELDCIIKKRDAENKQRKELEKNRQDTTFKKNEDMQIPKNL 74 Query: 290 KERIDKKDIDHKEKQKDANELAFENQHAKRERETQRNNMN----KFQRGKSAPAKQNRGK 457 I ++++DH ++++ E ++Q + E +TQR N +F K+A + Sbjct: 75 D--IGRREVDHNQQRQQIKE--NQSQRLQEEWQTQRRRNNNQQVRFHIDKTAVPQLQSQT 130 Query: 458 SMPPKQT 478 SM P T Sbjct: 131 SMVPIPT 137