BLASTX nr result
ID: Atropa21_contig00024493
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00024493 (466 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006360496.1| PREDICTED: uncharacterized protein LOC102583... 69 8e-10 ref|XP_004250011.1| PREDICTED: uncharacterized protein HI_0077-l... 69 8e-10 emb|CBI40196.3| unnamed protein product [Vitis vinifera] 62 6e-08 ref|XP_002262808.1| PREDICTED: uncharacterized protein HI_0077 [... 62 6e-08 gb|EXC25437.1| hypothetical protein L484_016820 [Morus notabilis] 62 1e-07 ref|XP_006378796.1| hypothetical protein POPTR_0010s23920g [Popu... 61 1e-07 ref|XP_002316417.1| hypothetical protein POPTR_0010s23920g [Popu... 61 1e-07 gb|ESW08553.1| hypothetical protein PHAVU_009G055000g [Phaseolus... 60 3e-07 ref|XP_004308754.1| PREDICTED: uncharacterized protein HI_0077-l... 60 3e-07 gb|EMJ19964.1| hypothetical protein PRUPE_ppa009479mg [Prunus pe... 60 4e-07 gb|EPS70621.1| hypothetical protein M569_04141, partial [Genlise... 59 7e-07 ref|NP_196072.1| uncharacterized protein [Arabidopsis thaliana] ... 59 7e-07 ref|XP_006485245.1| PREDICTED: uncharacterized protein LOC102607... 58 1e-06 ref|XP_006436592.1| hypothetical protein CICLE_v10032023mg [Citr... 58 1e-06 ref|XP_004502630.1| PREDICTED: uncharacterized protein HI_0077-l... 58 1e-06 ref|XP_004502629.1| PREDICTED: uncharacterized protein HI_0077-l... 58 1e-06 ref|XP_006286376.1| hypothetical protein CARUB_v10001615mg [Caps... 58 1e-06 ref|XP_003526701.1| PREDICTED: uncharacterized protein LOC100816... 58 1e-06 ref|XP_003602216.1| hypothetical protein MTR_3g091130 [Medicago ... 58 1e-06 gb|ACU17959.1| unknown [Glycine max] 58 1e-06 >ref|XP_006360496.1| PREDICTED: uncharacterized protein LOC102583350 [Solanum tuberosum] Length = 295 Score = 68.6 bits (166), Expect = 8e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 2 PLKPPFNEQARRAAGFGPQWYEPLAVKDYTV 94 PLKPPFNEQAR+AAGFGPQWYEPLAVKD+TV Sbjct: 264 PLKPPFNEQARKAAGFGPQWYEPLAVKDFTV 294 >ref|XP_004250011.1| PREDICTED: uncharacterized protein HI_0077-like [Solanum lycopersicum] Length = 295 Score = 68.6 bits (166), Expect = 8e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 2 PLKPPFNEQARRAAGFGPQWYEPLAVKDYTV 94 PLKPPFNEQAR+AAGFGPQWYEPLAVKD+TV Sbjct: 264 PLKPPFNEQARKAAGFGPQWYEPLAVKDFTV 294 >emb|CBI40196.3| unnamed protein product [Vitis vinifera] Length = 289 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 2 PLKPPFNEQARRAAGFGPQWYEPLAVKDYT 91 PLKPPFNE+AR+AAGFGPQWYEPLAVK+ T Sbjct: 255 PLKPPFNEEARKAAGFGPQWYEPLAVKEAT 284 >ref|XP_002262808.1| PREDICTED: uncharacterized protein HI_0077 [Vitis vinifera] Length = 310 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 2 PLKPPFNEQARRAAGFGPQWYEPLAVKDYT 91 PLKPPFNE+AR+AAGFGPQWYEPLAVK+ T Sbjct: 276 PLKPPFNEEARKAAGFGPQWYEPLAVKEAT 305 >gb|EXC25437.1| hypothetical protein L484_016820 [Morus notabilis] Length = 306 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +2 Query: 2 PLKPPFNEQARRAAGFGPQWYEPLAVKDYTVQ 97 PLKPPFNE+AR+AAGFGPQWY+PLA K+ T+Q Sbjct: 275 PLKPPFNEEARKAAGFGPQWYQPLAFKETTLQ 306 >ref|XP_006378796.1| hypothetical protein POPTR_0010s23920g [Populus trichocarpa] gi|550330478|gb|ERP56593.1| hypothetical protein POPTR_0010s23920g [Populus trichocarpa] Length = 240 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = +2 Query: 2 PLKPPFNEQARRAAGFGPQWYEPLAVKD 85 PLKPPFNE+AR+AAGFGPQWYEPLAVK+ Sbjct: 206 PLKPPFNEEARKAAGFGPQWYEPLAVKE 233 >ref|XP_002316417.1| hypothetical protein POPTR_0010s23920g [Populus trichocarpa] gi|222865457|gb|EEF02588.1| hypothetical protein POPTR_0010s23920g [Populus trichocarpa] Length = 314 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = +2 Query: 2 PLKPPFNEQARRAAGFGPQWYEPLAVKD 85 PLKPPFNE+AR+AAGFGPQWYEPLAVK+ Sbjct: 280 PLKPPFNEEARKAAGFGPQWYEPLAVKE 307 >gb|ESW08553.1| hypothetical protein PHAVU_009G055000g [Phaseolus vulgaris] Length = 300 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 2 PLKPPFNEQARRAAGFGPQWYEPLAVKD 85 PLKPPFNE AR+AAGFGPQWYEPLAVK+ Sbjct: 268 PLKPPFNEAARKAAGFGPQWYEPLAVKE 295 >ref|XP_004308754.1| PREDICTED: uncharacterized protein HI_0077-like [Fragaria vesca subsp. vesca] Length = 322 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +2 Query: 2 PLKPPFNEQARRAAGFGPQWYEPLAVKDYTV 94 PLKPPFNE+AR+AAGFGP+WYEPLAVK+ V Sbjct: 283 PLKPPFNEEARKAAGFGPKWYEPLAVKESKV 313 >gb|EMJ19964.1| hypothetical protein PRUPE_ppa009479mg [Prunus persica] Length = 291 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = +2 Query: 2 PLKPPFNEQARRAAGFGPQWYEPLAVKD 85 PLKPPFNE+AR+AAGFGP+WYEPLAVK+ Sbjct: 253 PLKPPFNEEARKAAGFGPRWYEPLAVKE 280 >gb|EPS70621.1| hypothetical protein M569_04141, partial [Genlisea aurea] Length = 63 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +2 Query: 2 PLKPPFNEQARRAAGFGPQWYEPLAVK 82 PLKPPFNE ARRAAGFGP+WYEPLA+K Sbjct: 37 PLKPPFNEAARRAAGFGPEWYEPLAIK 63 >ref|NP_196072.1| uncharacterized protein [Arabidopsis thaliana] gi|7406456|emb|CAB85558.1| 3-oxoacyl-[acyl-carrier-protein] synthase-like protein [Arabidopsis thaliana] gi|332003373|gb|AED90756.1| uncharacterized protein AT5G04520 [Arabidopsis thaliana] Length = 291 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 2 PLKPPFNEQARRAAGFGPQWYEPLAVKD 85 PLKPPFN +AR+AAGFGPQWYEPLAVK+ Sbjct: 261 PLKPPFNAEARKAAGFGPQWYEPLAVKE 288 >ref|XP_006485245.1| PREDICTED: uncharacterized protein LOC102607375 [Citrus sinensis] Length = 303 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +2 Query: 2 PLKPPFNEQARRAAGFGPQWYEPLAVKD 85 PLKPPFNE AR+AAGFGPQWYEPLA K+ Sbjct: 273 PLKPPFNEVARKAAGFGPQWYEPLATKE 300 >ref|XP_006436592.1| hypothetical protein CICLE_v10032023mg [Citrus clementina] gi|557538788|gb|ESR49832.1| hypothetical protein CICLE_v10032023mg [Citrus clementina] Length = 340 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +2 Query: 2 PLKPPFNEQARRAAGFGPQWYEPLAVKD 85 PLKPPFNE AR+AAGFGPQWYEPLA K+ Sbjct: 310 PLKPPFNEVARKAAGFGPQWYEPLATKE 337 >ref|XP_004502630.1| PREDICTED: uncharacterized protein HI_0077-like isoform X2 [Cicer arietinum] Length = 313 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +2 Query: 2 PLKPPFNEQARRAAGFGPQWYEPLAVK 82 PLKPPFNE AR+AAGFGP+WYEPLAVK Sbjct: 282 PLKPPFNEAARKAAGFGPEWYEPLAVK 308 >ref|XP_004502629.1| PREDICTED: uncharacterized protein HI_0077-like isoform X1 [Cicer arietinum] Length = 307 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +2 Query: 2 PLKPPFNEQARRAAGFGPQWYEPLAVK 82 PLKPPFNE AR+AAGFGP+WYEPLAVK Sbjct: 276 PLKPPFNEAARKAAGFGPEWYEPLAVK 302 >ref|XP_006286376.1| hypothetical protein CARUB_v10001615mg [Capsella rubella] gi|482555082|gb|EOA19274.1| hypothetical protein CARUB_v10001615mg [Capsella rubella] Length = 291 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +2 Query: 2 PLKPPFNEQARRAAGFGPQWYEPLAVK 82 PLKPPFN +AR+AAGFGPQWYEPLAVK Sbjct: 261 PLKPPFNAEARKAAGFGPQWYEPLAVK 287 >ref|XP_003526701.1| PREDICTED: uncharacterized protein LOC100816830 [Glycine max] Length = 304 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +2 Query: 2 PLKPPFNEQARRAAGFGPQWYEPLAVKD 85 PLKPPFNE AR+ AGFGPQWYEPLAVK+ Sbjct: 270 PLKPPFNEAARKEAGFGPQWYEPLAVKE 297 >ref|XP_003602216.1| hypothetical protein MTR_3g091130 [Medicago truncatula] gi|355491264|gb|AES72467.1| hypothetical protein MTR_3g091130 [Medicago truncatula] Length = 300 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +2 Query: 2 PLKPPFNEQARRAAGFGPQWYEPLAVK 82 PLKPPFNE AR+AAGFGP+WYEPLAVK Sbjct: 270 PLKPPFNEAARKAAGFGPEWYEPLAVK 296 >gb|ACU17959.1| unknown [Glycine max] Length = 232 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +2 Query: 2 PLKPPFNEQARRAAGFGPQWYEPLAVKD 85 PLKPPFNE AR+ AGFGPQWYEPLAVK+ Sbjct: 198 PLKPPFNEAARKEAGFGPQWYEPLAVKE 225