BLASTX nr result
ID: Atropa21_contig00022972
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00022972 (475 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006384178.1| hypothetical protein POPTR_0004s09260g, part... 62 8e-08 >ref|XP_006384178.1| hypothetical protein POPTR_0004s09260g, partial [Populus trichocarpa] gi|550340653|gb|ERP61975.1| hypothetical protein POPTR_0004s09260g, partial [Populus trichocarpa] Length = 141 Score = 62.0 bits (149), Expect = 8e-08 Identities = 35/60 (58%), Positives = 38/60 (63%) Frame = -1 Query: 304 ETSFMSEQAIFYLGSIGLLGEYCPWSRKKNRHFSGRVDCMHLKSSKEEHFHFSGCWKAQP 125 E SFMS QAI +LG IGLLGEY P RKK R S +V CMHL K + FSGC QP Sbjct: 51 EVSFMSIQAISFLGEIGLLGEYTPSLRKKGRPLSDKVGCMHLGPFK-GYPEFSGCSWVQP 109