BLASTX nr result
ID: Atropa21_contig00020319
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00020319 (1324 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006356960.1| PREDICTED: putative ribonuclease H protein A... 47 1e-07 >ref|XP_006356960.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Solanum tuberosum] Length = 514 Score = 47.4 bits (111), Expect(2) = 1e-07 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 2/63 (3%) Frame = +2 Query: 434 EAIDKIRIEFFRKGEPTKR*IHPVK*QQ*IHAKKKGGPGTKNLIAE--ILLIQWLWRSND 607 ++IDK+R F +G + +H VK + I +KK GG G KNL + LL +WLWR N Sbjct: 161 KSIDKLRRNFIWEGNGDSKRLHLVKWKTLISSKKAGGLGIKNLRIQNMSLLFKWLWRYNT 220 Query: 608 DQQ 616 ++Q Sbjct: 221 EEQ 223 Score = 37.0 bits (84), Expect(2) = 1e-07 Identities = 15/30 (50%), Positives = 23/30 (76%) Frame = +3 Query: 264 DKVAKKLATWKKQYLSTKGRVTLIDSNMDT 353 D+ ++LA WK QYLS+ GRV L++S +D+ Sbjct: 123 DRCERRLARWKAQYLSSGGRVVLVNSVLDS 152