BLASTX nr result
ID: Atropa21_contig00020225
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00020225 (610 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF17698.1|AC009243_25 F28K19.15 [Arabidopsis thaliana] 82 9e-14 ref|XP_004237879.1| PREDICTED: 60S ribosomal protein L30-like [S... 75 1e-11 gb|EPS59818.1| hypothetical protein M569_14987, partial [Genlise... 75 2e-11 gb|EXC06688.1| Putative 60S ribosomal protein L30-1 [Morus notab... 74 2e-11 ref|XP_006420774.1| hypothetical protein CICLE_v10006263mg [Citr... 74 4e-11 gb|ADB02906.1| 60S ribosomal protein L30 [Jatropha curcas] 74 4e-11 ref|XP_002528991.1| 60S ribosomal protein L30, putative [Ricinus... 73 5e-11 ref|XP_002281037.1| PREDICTED: 60S ribosomal protein L30 [Vitis ... 72 9e-11 ref|XP_006428122.1| hypothetical protein CICLE_v10026806mg [Citr... 72 1e-10 ref|XP_004140311.1| PREDICTED: 60S ribosomal protein L30-like is... 71 2e-10 ref|XP_002517499.1| 60S ribosomal protein L30, putative [Ricinus... 70 3e-10 ref|XP_002313617.1| 60S ribosomal protein L30 [Populus trichocar... 70 3e-10 gb|ABK94261.1| unknown [Populus trichocarpa] 70 3e-10 ref|XP_006406571.1| hypothetical protein EUTSA_v10021799mg [Eutr... 70 5e-10 ref|NP_174853.1| putative 60S ribosomal protein L30-1 [Arabidops... 70 5e-10 ref|XP_006390039.1| hypothetical protein EUTSA_v10019341mg [Eutr... 69 8e-10 ref|XP_004306457.1| PREDICTED: 60S ribosomal protein L30-like [F... 69 8e-10 ref|XP_004300009.1| PREDICTED: 60S ribosomal protein L30-like [F... 69 8e-10 ref|NP_565164.1| 60S ribosomal protein L30-2 [Arabidopsis thalia... 69 8e-10 ref|XP_002889167.1| 60S ribosomal protein L30 [Arabidopsis lyrat... 69 8e-10 >gb|AAF17698.1|AC009243_25 F28K19.15 [Arabidopsis thaliana] Length = 332 Score = 82.4 bits (202), Expect = 9e-14 Identities = 39/65 (60%), Positives = 47/65 (72%) Frame = +1 Query: 271 SSTKTSIFTTFLYMCSFALVALCVDNVDLGTACGKFHRVSCLSIIDPGDSDIIKSLPGDH 450 SS +F L+ C C DNVDLGTACGK+ RVSCLSI+DPGDSDIIKS+PGDH Sbjct: 105 SSLARPVFKDSLFSC------FCEDNVDLGTACGKYFRVSCLSIVDPGDSDIIKSIPGDH 158 Query: 451 *ELVI 465 +++I Sbjct: 159 TDMII 163 >ref|XP_004237879.1| PREDICTED: 60S ribosomal protein L30-like [Solanum lycopersicum] gi|565375002|ref|XP_006354030.1| PREDICTED: 60S ribosomal protein L30-like [Solanum tuberosum] Length = 113 Score = 75.1 bits (183), Expect = 1e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +1 Query: 343 DNVDLGTACGKFHRVSCLSIIDPGDSDIIKSLPGD 447 +NVDLGTACGKFHRVSCLSIIDPGDSDIIKSLPGD Sbjct: 78 NNVDLGTACGKFHRVSCLSIIDPGDSDIIKSLPGD 112 >gb|EPS59818.1| hypothetical protein M569_14987, partial [Genlisea aurea] Length = 109 Score = 74.7 bits (182), Expect = 2e-11 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +1 Query: 343 DNVDLGTACGKFHRVSCLSIIDPGDSDIIKSLPGDH 450 +NVDLGTACGK++RVSCLSIIDPGDSDIIKSLPGDH Sbjct: 74 NNVDLGTACGKYYRVSCLSIIDPGDSDIIKSLPGDH 109 >gb|EXC06688.1| Putative 60S ribosomal protein L30-1 [Morus notabilis] Length = 74 Score = 74.3 bits (181), Expect = 2e-11 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 5/50 (10%) Frame = +1 Query: 313 CSFALVALCV-----DNVDLGTACGKFHRVSCLSIIDPGDSDIIKSLPGD 447 CS + A C+ DNVDLGTACGK++RVSCLSI+DPGDSDIIKSLPGD Sbjct: 24 CSCRVEAPCLLVFRLDNVDLGTACGKYYRVSCLSILDPGDSDIIKSLPGD 73 >ref|XP_006420774.1| hypothetical protein CICLE_v10006263mg [Citrus clementina] gi|567855311|ref|XP_006420775.1| hypothetical protein CICLE_v10006263mg [Citrus clementina] gi|568868531|ref|XP_006487540.1| PREDICTED: 60S ribosomal protein L30-like [Citrus sinensis] gi|557522647|gb|ESR34014.1| hypothetical protein CICLE_v10006263mg [Citrus clementina] gi|557522648|gb|ESR34015.1| hypothetical protein CICLE_v10006263mg [Citrus clementina] Length = 112 Score = 73.6 bits (179), Expect = 4e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 343 DNVDLGTACGKFHRVSCLSIIDPGDSDIIKSLPGDH 450 +NVDLGTACGK+ RVSCLSIIDPGDSDIIKSLPGDH Sbjct: 77 NNVDLGTACGKYFRVSCLSIIDPGDSDIIKSLPGDH 112 >gb|ADB02906.1| 60S ribosomal protein L30 [Jatropha curcas] Length = 112 Score = 73.6 bits (179), Expect = 4e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 343 DNVDLGTACGKFHRVSCLSIIDPGDSDIIKSLPGDH 450 +NVDLGTACGK+ RVSCLSIIDPGDSDIIKSLPGDH Sbjct: 77 NNVDLGTACGKYFRVSCLSIIDPGDSDIIKSLPGDH 112 >ref|XP_002528991.1| 60S ribosomal protein L30, putative [Ricinus communis] gi|223531581|gb|EEF33410.1| 60S ribosomal protein L30, putative [Ricinus communis] Length = 112 Score = 73.2 bits (178), Expect = 5e-11 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +1 Query: 343 DNVDLGTACGKFHRVSCLSIIDPGDSDIIKSLPGDH 450 +NVDLGTACGK+ RVSCLSI+DPGDSDIIKSLPGDH Sbjct: 77 NNVDLGTACGKYFRVSCLSIVDPGDSDIIKSLPGDH 112 >ref|XP_002281037.1| PREDICTED: 60S ribosomal protein L30 [Vitis vinifera] gi|296082469|emb|CBI21474.3| unnamed protein product [Vitis vinifera] Length = 112 Score = 72.4 bits (176), Expect = 9e-11 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +1 Query: 343 DNVDLGTACGKFHRVSCLSIIDPGDSDIIKSLPGDH 450 +NVDLGTACGK+ RVSCLSIIDPGDSDIIK+LPGDH Sbjct: 77 NNVDLGTACGKYFRVSCLSIIDPGDSDIIKTLPGDH 112 >ref|XP_006428122.1| hypothetical protein CICLE_v10026806mg [Citrus clementina] gi|567871003|ref|XP_006428123.1| hypothetical protein CICLE_v10026806mg [Citrus clementina] gi|568819504|ref|XP_006464291.1| PREDICTED: 60S ribosomal protein L30-like [Citrus sinensis] gi|557530112|gb|ESR41362.1| hypothetical protein CICLE_v10026806mg [Citrus clementina] gi|557530113|gb|ESR41363.1| hypothetical protein CICLE_v10026806mg [Citrus clementina] Length = 112 Score = 72.0 bits (175), Expect = 1e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +1 Query: 343 DNVDLGTACGKFHRVSCLSIIDPGDSDIIKSLPGDH 450 +NVDLGTACGK+ RVSCLSIIDPGDSDIIKSLPG+H Sbjct: 77 NNVDLGTACGKYFRVSCLSIIDPGDSDIIKSLPGEH 112 >ref|XP_004140311.1| PREDICTED: 60S ribosomal protein L30-like isoform 1 [Cucumis sativus] gi|449445102|ref|XP_004140312.1| PREDICTED: 60S ribosomal protein L30-like isoform 2 [Cucumis sativus] gi|449479854|ref|XP_004155728.1| PREDICTED: 60S ribosomal protein L30-like isoform 1 [Cucumis sativus] gi|449479857|ref|XP_004155729.1| PREDICTED: 60S ribosomal protein L30-like isoform 2 [Cucumis sativus] Length = 112 Score = 71.2 bits (173), Expect = 2e-10 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 346 NVDLGTACGKFHRVSCLSIIDPGDSDIIKSLPGD 447 NVDLGTACGK++RVSCLSIIDPGDSDIIKSLPGD Sbjct: 78 NVDLGTACGKYYRVSCLSIIDPGDSDIIKSLPGD 111 >ref|XP_002517499.1| 60S ribosomal protein L30, putative [Ricinus communis] gi|223543510|gb|EEF45041.1| 60S ribosomal protein L30, putative [Ricinus communis] Length = 112 Score = 70.5 bits (171), Expect = 3e-10 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +1 Query: 343 DNVDLGTACGKFHRVSCLSIIDPGDSDIIKSLPGDH 450 +NVDLGTACGK++RV CLSIIDPGDSDIIKS+PG+H Sbjct: 77 NNVDLGTACGKYYRVCCLSIIDPGDSDIIKSMPGEH 112 >ref|XP_002313617.1| 60S ribosomal protein L30 [Populus trichocarpa] gi|224131730|ref|XP_002328094.1| predicted protein [Populus trichocarpa] gi|566167641|ref|XP_006384747.1| 60S ribosomal protein L30 [Populus trichocarpa] gi|118483895|gb|ABK93838.1| unknown [Populus trichocarpa] gi|222850025|gb|EEE87572.1| 60S ribosomal protein L30 [Populus trichocarpa] gi|550341515|gb|ERP62544.1| 60S ribosomal protein L30 [Populus trichocarpa] Length = 112 Score = 70.5 bits (171), Expect = 3e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 343 DNVDLGTACGKFHRVSCLSIIDPGDSDIIKSLPGDH 450 +NVDLGTACGK+ RV CLSIIDPGDSDIIKS+PGDH Sbjct: 77 NNVDLGTACGKYFRVCCLSIIDPGDSDIIKSVPGDH 112 >gb|ABK94261.1| unknown [Populus trichocarpa] Length = 112 Score = 70.5 bits (171), Expect = 3e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 343 DNVDLGTACGKFHRVSCLSIIDPGDSDIIKSLPGDH 450 +NVDLGTACGK+ RV CLSIIDPGDSDIIKS+PGDH Sbjct: 77 NNVDLGTACGKYFRVCCLSIIDPGDSDIIKSVPGDH 112 >ref|XP_006406571.1| hypothetical protein EUTSA_v10021799mg [Eutrema salsugineum] gi|567197445|ref|XP_006406572.1| hypothetical protein EUTSA_v10021801mg [Eutrema salsugineum] gi|557107717|gb|ESQ48024.1| hypothetical protein EUTSA_v10021799mg [Eutrema salsugineum] gi|557107718|gb|ESQ48025.1| hypothetical protein EUTSA_v10021801mg [Eutrema salsugineum] Length = 112 Score = 70.1 bits (170), Expect = 5e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 343 DNVDLGTACGKFHRVSCLSIIDPGDSDIIKSLPGD 447 +NVDLGTACGK+ RVSCLSI+DPGDSDIIKSLPGD Sbjct: 77 NNVDLGTACGKYFRVSCLSIVDPGDSDIIKSLPGD 111 >ref|NP_174853.1| putative 60S ribosomal protein L30-1 [Arabidopsis thaliana] gi|75169512|sp|Q9C8F7.1|RL301_ARATH RecName: Full=Putative 60S ribosomal protein L30-1 gi|12322482|gb|AAG51255.1|AC025781_7 60S ribosomal protein L30, putative; 78827-80170 [Arabidopsis thaliana] gi|332193733|gb|AEE31854.1| putative 60S ribosomal protein L30-1 [Arabidopsis thaliana] Length = 112 Score = 70.1 bits (170), Expect = 5e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 343 DNVDLGTACGKFHRVSCLSIIDPGDSDIIKSLPGD 447 +NVDLGTACGK+ RVSCLSI+DPGDSDIIKSLPGD Sbjct: 77 NNVDLGTACGKYFRVSCLSIVDPGDSDIIKSLPGD 111 >ref|XP_006390039.1| hypothetical protein EUTSA_v10019341mg [Eutrema salsugineum] gi|557086473|gb|ESQ27325.1| hypothetical protein EUTSA_v10019341mg [Eutrema salsugineum] Length = 112 Score = 69.3 bits (168), Expect = 8e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +1 Query: 343 DNVDLGTACGKFHRVSCLSIIDPGDSDIIKSLPGD 447 +NVDLGTACGK+ RVSCLSI+DPGDSDIIKS+PGD Sbjct: 77 NNVDLGTACGKYFRVSCLSIVDPGDSDIIKSIPGD 111 >ref|XP_004306457.1| PREDICTED: 60S ribosomal protein L30-like [Fragaria vesca subsp. vesca] Length = 112 Score = 69.3 bits (168), Expect = 8e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 343 DNVDLGTACGKFHRVSCLSIIDPGDSDIIKSLPGD 447 +NVDLGTACGK+ RVSCLSIIDPGDSDIIK+LPGD Sbjct: 77 NNVDLGTACGKYFRVSCLSIIDPGDSDIIKTLPGD 111 >ref|XP_004300009.1| PREDICTED: 60S ribosomal protein L30-like [Fragaria vesca subsp. vesca] gi|470129508|ref|XP_004300658.1| PREDICTED: 60S ribosomal protein L30-like [Fragaria vesca subsp. vesca] Length = 112 Score = 69.3 bits (168), Expect = 8e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 343 DNVDLGTACGKFHRVSCLSIIDPGDSDIIKSLPGD 447 +NVDLGTACGK+ RVSCLSIIDPGDSDIIK+LPGD Sbjct: 77 NNVDLGTACGKYFRVSCLSIIDPGDSDIIKTLPGD 111 >ref|NP_565164.1| 60S ribosomal protein L30-2 [Arabidopsis thaliana] gi|75161573|sp|Q8VZ19.1|RL302_ARATH RecName: Full=60S ribosomal protein L30-2 gi|17529170|gb|AAL38811.1| putative ribosomal protein L30 [Arabidopsis thaliana] gi|21280849|gb|AAM45084.1| putative ribosomal protein L30 [Arabidopsis thaliana] gi|21554013|gb|AAM63094.1| ribosomal protein L30, putative [Arabidopsis thaliana] gi|28466813|gb|AAO44015.1| At1g77940 [Arabidopsis thaliana] gi|110736052|dbj|BAE99998.1| similar to ribosomal protein L30 [Arabidopsis thaliana] gi|332197928|gb|AEE36049.1| 60S ribosomal protein L30-2 [Arabidopsis thaliana] Length = 112 Score = 69.3 bits (168), Expect = 8e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +1 Query: 343 DNVDLGTACGKFHRVSCLSIIDPGDSDIIKSLPGD 447 +NVDLGTACGK+ RVSCLSI+DPGDSDIIKS+PGD Sbjct: 77 NNVDLGTACGKYFRVSCLSIVDPGDSDIIKSIPGD 111 >ref|XP_002889167.1| 60S ribosomal protein L30 [Arabidopsis lyrata subsp. lyrata] gi|565490763|ref|XP_006303021.1| hypothetical protein CARUB_v10021177mg [Capsella rubella] gi|297335008|gb|EFH65426.1| 60S ribosomal protein L30 [Arabidopsis lyrata subsp. lyrata] gi|482571731|gb|EOA35919.1| hypothetical protein CARUB_v10021177mg [Capsella rubella] Length = 112 Score = 69.3 bits (168), Expect = 8e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +1 Query: 343 DNVDLGTACGKFHRVSCLSIIDPGDSDIIKSLPGD 447 +NVDLGTACGK+ RVSCLSI+DPGDSDIIKS+PGD Sbjct: 77 NNVDLGTACGKYFRVSCLSIVDPGDSDIIKSIPGD 111