BLASTX nr result
ID: Atropa21_contig00020091
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00020091 (626 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004245130.1| PREDICTED: RNA polymerase sigma factor sigC-... 69 1e-09 ref|XP_006355305.1| PREDICTED: RNA polymerase sigma factor sigC-... 68 2e-09 >ref|XP_004245130.1| PREDICTED: RNA polymerase sigma factor sigC-like [Solanum lycopersicum] Length = 551 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/40 (82%), Positives = 35/40 (87%), Gaps = 2/40 (5%) Frame = -1 Query: 116 FIHNNTS--SSHSFKGREALYDPARSLKPFINGDCEPSHS 3 F N++S SSHSFKGRE LYDPARSLKPFINGDCEPSHS Sbjct: 17 FSSNSSSWPSSHSFKGRETLYDPARSLKPFINGDCEPSHS 56 >ref|XP_006355305.1| PREDICTED: RNA polymerase sigma factor sigC-like [Solanum tuberosum] Length = 555 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/40 (82%), Positives = 35/40 (87%), Gaps = 2/40 (5%) Frame = -1 Query: 116 FIHNNTS--SSHSFKGREALYDPARSLKPFINGDCEPSHS 3 F N++S SSHSFKGREALYDPARSLKPFI GDCEPSHS Sbjct: 17 FSSNSSSWPSSHSFKGREALYDPARSLKPFITGDCEPSHS 56