BLASTX nr result
ID: Atropa21_contig00020059
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00020059 (709 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004245756.1| PREDICTED: scarecrow-like protein 27-like is... 90 5e-17 ref|XP_004245757.1| PREDICTED: scarecrow-like protein 27-like is... 89 1e-15 ref|XP_006355471.1| PREDICTED: scarecrow-like protein 22-like [S... 85 2e-14 gb|AFV91191.1| GRAS family transcription regulator [Capsicum ann... 72 2e-10 >ref|XP_004245756.1| PREDICTED: scarecrow-like protein 27-like isoform 1 [Solanum lycopersicum] Length = 745 Score = 89.7 bits (221), Expect(2) = 5e-17 Identities = 45/55 (81%), Positives = 49/55 (89%), Gaps = 3/55 (5%) Frame = +2 Query: 518 KMIVIPQNNNIPAKGVLDVSGFMPSISS---PEAQICKKDTNFTRNEPVSVLDTR 673 +MIVIPQ+NN+PAKGVL VSGF+PSISS PEA ICKKD NFTRNEPVSVLDTR Sbjct: 44 QMIVIPQSNNLPAKGVLGVSGFVPSISSSSSPEASICKKDANFTRNEPVSVLDTR 98 Score = 24.6 bits (52), Expect(2) = 5e-17 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +1 Query: 478 VQILVKYKINQVTK 519 V+ILVKYKI QV K Sbjct: 3 VKILVKYKIRQVAK 16 >ref|XP_004245757.1| PREDICTED: scarecrow-like protein 27-like isoform 2 [Solanum lycopersicum] Length = 701 Score = 89.4 bits (220), Expect = 1e-15 Identities = 45/54 (83%), Positives = 48/54 (88%), Gaps = 3/54 (5%) Frame = +2 Query: 521 MIVIPQNNNIPAKGVLDVSGFMPSISS---PEAQICKKDTNFTRNEPVSVLDTR 673 MIVIPQ+NN+PAKGVL VSGF+PSISS PEA ICKKD NFTRNEPVSVLDTR Sbjct: 1 MIVIPQSNNLPAKGVLGVSGFVPSISSSSSPEASICKKDANFTRNEPVSVLDTR 54 >ref|XP_006355471.1| PREDICTED: scarecrow-like protein 22-like [Solanum tuberosum] Length = 700 Score = 85.1 bits (209), Expect = 2e-14 Identities = 43/54 (79%), Positives = 48/54 (88%), Gaps = 3/54 (5%) Frame = +2 Query: 521 MIVIPQNNNIPAKGVLDVSGFMPSISS---PEAQICKKDTNFTRNEPVSVLDTR 673 MIVIPQ++++PAKGVL VSGF+PSISS PEA ICKKD NFTRNEPVSVLDTR Sbjct: 1 MIVIPQSSSLPAKGVLGVSGFVPSISSSSSPEAAICKKDANFTRNEPVSVLDTR 54 >gb|AFV91191.1| GRAS family transcription regulator [Capsicum annuum] Length = 693 Score = 71.6 bits (174), Expect = 2e-10 Identities = 40/56 (71%), Positives = 42/56 (75%), Gaps = 5/56 (8%) Frame = +2 Query: 521 MIVIPQNNNIPAKGVLDVSGFMPSI-----SSPEAQICKKDTNFTRNEPVSVLDTR 673 MIVIPQ N+IPAKGVL VS F+PSI SS EA I KD NFTRNEPVS LDTR Sbjct: 1 MIVIPQGNSIPAKGVLCVSNFVPSITSSSSSSQEAPIFMKDANFTRNEPVSELDTR 56