BLASTX nr result
ID: Atropa21_contig00018951
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00018951 (1099 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006351837.1| PREDICTED: B3 domain-containing protein At5g... 58 8e-06 >ref|XP_006351837.1| PREDICTED: B3 domain-containing protein At5g60140-like [Solanum tuberosum] Length = 350 Score = 57.8 bits (138), Expect = 8e-06 Identities = 27/40 (67%), Positives = 30/40 (75%) Frame = +2 Query: 383 EENTVEFGDSLIFYYDGNGVFDFKVLENTCCEMKGAKGLK 502 E+NTVE GD LIF YDGN +FDFK+L T CE KG GLK Sbjct: 68 EDNTVEVGDFLIFDYDGNKIFDFKLLGRTKCEKKGVGGLK 107