BLASTX nr result
ID: Atropa21_contig00018682
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00018682 (550 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006346418.1| PREDICTED: B3 domain-containing protein Os01... 92 1e-16 ref|XP_006346416.1| PREDICTED: B3 domain-containing protein Os01... 92 1e-16 ref|XP_004230782.1| PREDICTED: B3 domain-containing protein At5g... 88 1e-15 >ref|XP_006346418.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform X3 [Solanum tuberosum] Length = 267 Score = 91.7 bits (226), Expect = 1e-16 Identities = 48/60 (80%), Positives = 49/60 (81%), Gaps = 5/60 (8%) Frame = +1 Query: 1 SHSAVDLTVSPS-----NNSEDLDSEVLEGSDVTNRLQSNKICYSETSFLHDNRQKSITC 165 SH AVDL VSPS NNSEDLDSEVLEGSDVTNRLQSN+IC SETSFLHDN KSI C Sbjct: 207 SHCAVDLNVSPSEHRSENNSEDLDSEVLEGSDVTNRLQSNEICCSETSFLHDNPHKSIAC 266 >ref|XP_006346416.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform X1 [Solanum tuberosum] Length = 334 Score = 91.7 bits (226), Expect = 1e-16 Identities = 48/60 (80%), Positives = 49/60 (81%), Gaps = 5/60 (8%) Frame = +1 Query: 1 SHSAVDLTVSPS-----NNSEDLDSEVLEGSDVTNRLQSNKICYSETSFLHDNRQKSITC 165 SH AVDL VSPS NNSEDLDSEVLEGSDVTNRLQSN+IC SETSFLHDN KSI C Sbjct: 274 SHCAVDLNVSPSEHRSENNSEDLDSEVLEGSDVTNRLQSNEICCSETSFLHDNPHKSIAC 333 >ref|XP_004230782.1| PREDICTED: B3 domain-containing protein At5g42700-like [Solanum lycopersicum] Length = 336 Score = 88.2 bits (217), Expect = 1e-15 Identities = 45/60 (75%), Positives = 48/60 (80%), Gaps = 5/60 (8%) Frame = +1 Query: 1 SHSAVDLTVSPS-----NNSEDLDSEVLEGSDVTNRLQSNKICYSETSFLHDNRQKSITC 165 SH VDL VSPS NNSEDLDSEVL+GSDVTNRLQSN+IC SETSFLHDN KS+ C Sbjct: 276 SHCTVDLNVSPSEHRSENNSEDLDSEVLQGSDVTNRLQSNEICCSETSFLHDNPHKSVDC 335