BLASTX nr result
ID: Atropa21_contig00018491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00018491 (1284 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABI34281.1| hypothetical protein SDM1_22t00011 [Solanum demis... 60 3e-06 >gb|ABI34281.1| hypothetical protein SDM1_22t00011 [Solanum demissum] Length = 155 Score = 59.7 bits (143), Expect = 3e-06 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = +2 Query: 917 SKTKIKTTGVIHGIPTLQFRTDERQELAKEEGFHKAIVVKLSSGAPDLSTM 1069 SKT +K+ +IHG PT+ F +ERQ+ EEG H+A+V KLS GAPDL + Sbjct: 44 SKTIVKSIEIIHGEPTITFSMEERQDFMIEEGLHQAVVFKLSHGAPDLKVL 94