BLASTX nr result
ID: Atropa21_contig00017381
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00017381 (656 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006361038.1| PREDICTED: trafficking protein particle comp... 69 2e-09 ref|XP_004248116.1| PREDICTED: UPF0533 protein C5orf44 homolog [... 69 2e-09 >ref|XP_006361038.1| PREDICTED: trafficking protein particle complex subunit 13-like [Solanum tuberosum] Length = 449 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +3 Query: 3 KHGVQKITGITVFDAREKKTYDSLLELEVFVDSQ 104 KHGVQKITGITVFD REKKTYDSLLELEVFVDSQ Sbjct: 416 KHGVQKITGITVFDTREKKTYDSLLELEVFVDSQ 449 >ref|XP_004248116.1| PREDICTED: UPF0533 protein C5orf44 homolog [Solanum lycopersicum] Length = 446 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +3 Query: 3 KHGVQKITGITVFDAREKKTYDSLLELEVFVDSQ 104 KHGVQKITGITVFD REKKTYDSLLELEVFVDSQ Sbjct: 413 KHGVQKITGITVFDTREKKTYDSLLELEVFVDSQ 446