BLASTX nr result
ID: Atropa21_contig00017098
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00017098 (950 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006366442.1| PREDICTED: uncharacterized protein LOC102589... 60 2e-06 ref|XP_004238206.1| PREDICTED: uncharacterized protein LOC101244... 60 2e-06 >ref|XP_006366442.1| PREDICTED: uncharacterized protein LOC102589324 [Solanum tuberosum] Length = 351 Score = 59.7 bits (143), Expect = 2e-06 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -2 Query: 115 LKSTATFAEIVSSFFSEFMFYIGLATYLRVTNHVQKPY 2 L AT AEIVSS FSE MFYIGLATYLRVT+ VQKPY Sbjct: 158 LIKNATLAEIVSSLFSEVMFYIGLATYLRVTDSVQKPY 195 >ref|XP_004238206.1| PREDICTED: uncharacterized protein LOC101244367 [Solanum lycopersicum] Length = 351 Score = 59.7 bits (143), Expect = 2e-06 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -2 Query: 115 LKSTATFAEIVSSFFSEFMFYIGLATYLRVTNHVQKPY 2 L AT AEIVSS FSE MFYIGLATYLRVT+ VQKPY Sbjct: 158 LIKNATLAEIVSSLFSEVMFYIGLATYLRVTDSVQKPY 195