BLASTX nr result
ID: Atropa21_contig00016261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00016261 (510 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAW28576.2| Gag-pol polyprotein, putative [Solanum demissum] 69 5e-10 gb|AAW28578.1| Putative gag-pol polyprotein, identical [Solanum ... 69 5e-10 gb|AAW28577.1| Putative gag-pol polyprotein, identical [Solanum ... 69 5e-10 >gb|AAW28576.2| Gag-pol polyprotein, putative [Solanum demissum] Length = 1096 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/62 (54%), Positives = 44/62 (70%) Frame = -3 Query: 286 KDMDDALKVPRRPMTRSQTRNFEDKLNGL*LAIKKCLVMEEEVQPNQDIFLKPYTYLKVQ 107 KD DDAL+ PRRP+TRSQT+ F DKLNGL I++ L+ EEE++P + K Y YL Q Sbjct: 1029 KDKDDALETPRRPITRSQTKEFNDKLNGLQSLIQRFLIGEEELKPKGEELSKCYNYLVAQ 1088 Query: 106 IK 101 I+ Sbjct: 1089 IQ 1090 >gb|AAW28578.1| Putative gag-pol polyprotein, identical [Solanum demissum] Length = 1588 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/62 (54%), Positives = 44/62 (70%) Frame = -3 Query: 286 KDMDDALKVPRRPMTRSQTRNFEDKLNGL*LAIKKCLVMEEEVQPNQDIFLKPYTYLKVQ 107 KD DDAL+ PRRP+TRSQT+ F DKLNGL I++ L+ EEE++P + K Y YL Q Sbjct: 1521 KDKDDALETPRRPITRSQTKEFNDKLNGLQSLIQRFLIGEEELKPKGEELSKCYNYLVAQ 1580 Query: 106 IK 101 I+ Sbjct: 1581 IQ 1582 >gb|AAW28577.1| Putative gag-pol polyprotein, identical [Solanum demissum] Length = 1588 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/62 (54%), Positives = 44/62 (70%) Frame = -3 Query: 286 KDMDDALKVPRRPMTRSQTRNFEDKLNGL*LAIKKCLVMEEEVQPNQDIFLKPYTYLKVQ 107 KD DDAL+ PRRP+TRSQT+ F DKLNGL I++ L+ EEE++P + K Y YL Q Sbjct: 1521 KDKDDALETPRRPITRSQTKEFNDKLNGLQSLIQRFLIGEEELKPKGEELSKCYNYLVAQ 1580 Query: 106 IK 101 I+ Sbjct: 1581 IQ 1582